Recent changes to this wiki:
Merge branch 'master' of ssh://clonotyper.branchable.com
Announce support of SAMtools version 1.3 or higher.
diff --git a/index.mdwn b/index.mdwn index 717f931..5694454 100644 --- a/index.mdwn +++ b/index.mdwn @@ -51,6 +51,7 @@ See also the [OMICtool](http://omictools.com/rep-seq-c424-p1.html) website for a ### Recent news + * June 2017: Minor update to support the use of SAMtools version 1.3 or higher. * October 2015: Application note preprint deposited in [bioRxiv](http://biorxiv.org/content/early/2015/10/08/028696). * October 2014: New stable version [1.4](http://www.bioconductor.org/packages/3.0/bioc/html/clonotypeR.html) released on Bioconductor.
Support the use of older and newer versions of SAMtools.
diff --git a/scripts/clonotypeR b/scripts/clonotypeR
index a655325..7c7055f 100755
--- a/scripts/clonotypeR
+++ b/scripts/clonotypeR
@@ -52,6 +52,19 @@ function test_extract_dir {
fi
}
+# There was a backward-incompatible change of syntax for "samtools sort" in version 1.3.
+# https://github.com/samtools/samtools/blob/develop/NEWS
+function samtools_sort {
+ samtools 2>&1 | grep Version | grep -q htslib
+ if [ $? -ne 0 ]
+ then
+ printf "Your samtools version is old; consider upgrading\n"
+ samtools sort - $1
+ else
+ samtools sort - -o $1.bam
+ fi
+}
+
case $1 in
detect)
shift
@@ -62,7 +75,7 @@ case $1 in
LIBRARY=$(basename $FASTQ_FILE .fastq)
bwa bwasw -t${THREADS:-1} $CLONOTYPER_REFERENCE/V-C/index $FASTQ_FILE |
samtools view -Su - |
- samtools sort - $EXTRACT_DIR/$LIBRARY
+ samtools_sort $EXTRACT_DIR/$LIBRARY
samtools index $EXTRACT_DIR/$LIBRARY.bam
done
;;
Link to TraCeR, https://github.com/Teichlab/tracer
diff --git a/index.mdwn b/index.mdwn index 70612c6..a26f91b 100644 --- a/index.mdwn +++ b/index.mdwn @@ -42,6 +42,7 @@ to try alternative solutions, you can have a look at [MiXCR](https://milaboratory.com/software/mixcr/), [LymAnalyzer](http://nar.oxfordjournals.org/content/44/4/e31.full), [tcR](https://imminfo.github.io/tcr/), +[TraCeR](https://github.com/Teichlab/tracer), [VDJviz](https://github.com/antigenomics/vdjviz), or [VDJtools](https://github.com/mikessh/vdjtools). See also the [OMICtool](http://omictools.com/rep-seq-c424-p1.html) website for a longer list of repertoire tools.
MiXCR
diff --git a/index.mdwn b/index.mdwn index 717f931..70612c6 100644 --- a/index.mdwn +++ b/index.mdwn @@ -39,6 +39,7 @@ to try alternative solutions, you can have a look at [Decombinator](http://pubmed.gov/23303508 "Bioinformatics. 2013 Mar 1;29(5):542-50"), [MiTCR](http://mitcr.milaboratory.com/), [MIGEC](http://migec.readthedocs.org/en/latest/cdrblast.html), +[MiXCR](https://milaboratory.com/software/mixcr/), [LymAnalyzer](http://nar.oxfordjournals.org/content/44/4/e31.full), [tcR](https://imminfo.github.io/tcr/), [VDJviz](https://github.com/antigenomics/vdjviz), or
Link to tcR.
diff --git a/index.mdwn b/index.mdwn index 293d9aa..717f931 100644 --- a/index.mdwn +++ b/index.mdwn @@ -40,6 +40,7 @@ to try alternative solutions, you can have a look at [MiTCR](http://mitcr.milaboratory.com/), [MIGEC](http://migec.readthedocs.org/en/latest/cdrblast.html), [LymAnalyzer](http://nar.oxfordjournals.org/content/44/4/e31.full), +[tcR](https://imminfo.github.io/tcr/), [VDJviz](https://github.com/antigenomics/vdjviz), or [VDJtools](https://github.com/mikessh/vdjtools). See also the [OMICtool](http://omictools.com/rep-seq-c424-p1.html) website for a longer list of repertoire tools.
VDJviz
diff --git a/index.mdwn b/index.mdwn index 4745394..293d9aa 100644 --- a/index.mdwn +++ b/index.mdwn @@ -39,7 +39,8 @@ to try alternative solutions, you can have a look at [Decombinator](http://pubmed.gov/23303508 "Bioinformatics. 2013 Mar 1;29(5):542-50"), [MiTCR](http://mitcr.milaboratory.com/), [MIGEC](http://migec.readthedocs.org/en/latest/cdrblast.html), -[LymAnalyzer](http://nar.oxfordjournals.org/content/44/4/e31.full), or +[LymAnalyzer](http://nar.oxfordjournals.org/content/44/4/e31.full), +[VDJviz](https://github.com/antigenomics/vdjviz), or [VDJtools](https://github.com/mikessh/vdjtools). See also the [OMICtool](http://omictools.com/rep-seq-c424-p1.html) website for a longer list of repertoire tools.
Version bump to trigger package rebuilding now that purl()'ing issue
has been correctly identified. knitr does not create purl()'ed
(Stangle equivalent) .R files if _R_CHECK_TIMINGS_ is set, which
the build system was setting. Now it's not set, so these .R files are
now created. See https://github.com/yihui/knitr/issues/1212 for more.
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@117512 bc3139a8-67e5-0310-9ffc-ced21a209358
has been correctly identified. knitr does not create purl()'ed
(Stangle equivalent) .R files if _R_CHECK_TIMINGS_ is set, which
the build system was setting. Now it's not set, so these .R files are
now created. See https://github.com/yihui/knitr/issues/1212 for more.
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@117512 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/DESCRIPTION b/DESCRIPTION index 34c27ab..eb10cc0 100644 --- a/DESCRIPTION +++ b/DESCRIPTION @@ -1,7 +1,7 @@ Package: clonotypeR Type: Package Title: High throughput analysis of T cell antigen receptor sequences -Version: 1.11.1 +Version: 1.11.2 Date: 2016-04-23 Author: Charles Plessy <plessy@riken.jp> Maintainer: Charles Plessy <plessy@riken.jp>
Bump version of all packages that use knitr for vignettes.
This is because of an issue (now fixed) in knitr which failed to
create purl()'ed R files from vignette sources and include them in the
package. This version bump will cause these packages to propagate
with those R files included.
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@117323 bc3139a8-67e5-0310-9ffc-ced21a209358
This is because of an issue (now fixed) in knitr which failed to
create purl()'ed R files from vignette sources and include them in the
package. This version bump will cause these packages to propagate
with those R files included.
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@117323 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/DESCRIPTION b/DESCRIPTION index 31dd866..34c27ab 100644 --- a/DESCRIPTION +++ b/DESCRIPTION @@ -1,7 +1,7 @@ Package: clonotypeR Type: Package Title: High throughput analysis of T cell antigen receptor sequences -Version: 1.11.0 +Version: 1.11.1 Date: 2016-04-23 Author: Charles Plessy <plessy@riken.jp> Maintainer: Charles Plessy <plessy@riken.jp>
bump version after creating 3.3 branch
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@117081 bc3139a8-67e5-0310-9ffc-ced21a209358
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@117081 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/DESCRIPTION b/DESCRIPTION index 27b25a2..31dd866 100644 --- a/DESCRIPTION +++ b/DESCRIPTION @@ -1,7 +1,7 @@ Package: clonotypeR Type: Package Title: High throughput analysis of T cell antigen receptor sequences -Version: 1.10.0 +Version: 1.11.0 Date: 2016-04-23 Author: Charles Plessy <plessy@riken.jp> Maintainer: Charles Plessy <plessy@riken.jp>
Bump versions prior to creation of 3.3 branch
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@117079 bc3139a8-67e5-0310-9ffc-ced21a209358
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@117079 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/DESCRIPTION b/DESCRIPTION index 2f4b79c..27b25a2 100644 --- a/DESCRIPTION +++ b/DESCRIPTION @@ -1,7 +1,7 @@ Package: clonotypeR Type: Package Title: High throughput analysis of T cell antigen receptor sequences -Version: 1.9.1 +Version: 1.10.0 Date: 2016-04-23 Author: Charles Plessy <plessy@riken.jp> Maintainer: Charles Plessy <plessy@riken.jp>
Increment minor version number to trigger update.
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@116714 bc3139a8-67e5-0310-9ffc-ced21a209358
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@116714 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/ChangeLog b/ChangeLog index 3fad651..460527f 100644 --- a/ChangeLog +++ b/ChangeLog @@ -1,3 +1,6 @@ +2016-04-23 Charles Plessy <plessy@riken.jp> + * Increment minor version number to trigger update. + 2016-04-17 Charles Plessy <plessy@riken.jp> * Added citation information. * Point URL to the Branchable homepage. diff --git a/DESCRIPTION b/DESCRIPTION index 1d65d56..2f4b79c 100644 --- a/DESCRIPTION +++ b/DESCRIPTION @@ -1,8 +1,8 @@ Package: clonotypeR Type: Package Title: High throughput analysis of T cell antigen receptor sequences -Version: 1.9.0 -Date: 2016-04-17 +Version: 1.9.1 +Date: 2016-04-23 Author: Charles Plessy <plessy@riken.jp> Maintainer: Charles Plessy <plessy@riken.jp> Description: High throughput analysis of T cell antigen receptor sequences
Updated NEWS page.
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@116419 bc3139a8-67e5-0310-9ffc-ced21a209358
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@116419 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/NEWS b/NEWS index 1f8f401..d26b239 100644 --- a/NEWS +++ b/NEWS @@ -1,3 +1,9 @@ +Changes in version 1.10.0 + +OTHER CHANGES + + o Minor metadata updates. + Changes in version 1.8.0 NEW FEATURES
Added URL in DESCRIPTION and updated data.
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@116418 bc3139a8-67e5-0310-9ffc-ced21a209358
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@116418 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/DESCRIPTION b/DESCRIPTION index cda02f5..1d65d56 100644 --- a/DESCRIPTION +++ b/DESCRIPTION @@ -2,7 +2,7 @@ Package: clonotypeR Type: Package Title: High throughput analysis of T cell antigen receptor sequences Version: 1.9.0 -Date: 2015-10-06 +Date: 2016-04-17 Author: Charles Plessy <plessy@riken.jp> Maintainer: Charles Plessy <plessy@riken.jp> Description: High throughput analysis of T cell antigen receptor sequences @@ -20,4 +20,5 @@ Suggests: BiocGenerics, edgeR, knitr, pvclust, RUnit, vegan VignetteBuilder: knitr Packaged: 2013-12-11 10:22:39 UTC; charles biocViews: Sequencing +URL: http://clonotyper.branchable.com/ BugReports: http://clonotyper.branchable.com/Bugs/
Updated changelog.
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@116417 bc3139a8-67e5-0310-9ffc-ced21a209358
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@116417 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/ChangeLog b/ChangeLog index 06e2de0..3fad651 100644 --- a/ChangeLog +++ b/ChangeLog @@ -1,3 +1,10 @@ +2016-04-17 Charles Plessy <plessy@riken.jp> + * Added citation information. + * Point URL to the Branchable homepage. + +2015-02-05 Charles Plessy <plessy@riken.jp> + * Aded the function private_clonotypes(). + 2014-09-25 Charles Plessy <plessy@riken.jp> * Version 1.3.2 * Import “methods” instead of depending on.
Preprint released in biorXiv.
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@116416 bc3139a8-67e5-0310-9ffc-ced21a209358
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@116416 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/inst/CITATION b/inst/CITATION new file mode 100644 index 0000000..52cdbf0 --- /dev/null +++ b/inst/CITATION @@ -0,0 +1,16 @@ +citEntry( entry = "article" + , author = "Plessy, Charles and Mariotti-Ferrandiz, Encarnita and Manabe, Ri-Ichiroh and Hori, Shohei" + , title = "clonotypeR--high throughput analysis of T cell antigen receptor sequences" + , year = "2015" + , doi = "10.1101/028696" + , publisher = "Cold Spring Harbor Labs Journals" + , abstract = "Motivation The T cell receptors are expressed as millions of different rearrangements. Amplified as a complex mixture of PCR products, they can be sequenced directly on next-generation instruments without the need for cloning. This method is increasingly used to characterize, quantify and study these highly diverse receptors. Results We present here clonotypeR, a software package to identify and analyze antigen receptors from high-throughput sequence libraries. ClonotypeR is designed to process, organize and analyze very large numbers of sequences, in the order of millions, typically produced by Roche 454 or Illumina instruments, and is made of two parts. The first contains shell scripts and reference segment sequences to produce a data file where each line represents a the detection of a clonotype in a sequence read. The second part is a R module available from Bioconductor, to load and filter the data, and prepare clonotype abundance tables ready for analysis with third-party tools for differential representation analysis, sample clustering, etc. To analyze clonotype data at the nucleotide level, we introduce unique clonotype identifiers based on those developed by Yassai et al. (2009), that we corrected to avoid identifier collisions. Availability http://clonotyper.branchable.com (CC0 license)." + , URL = "http://www.biorxiv.org/content/early/2015/10/08/028696" + , eprint = "http://www.biorxiv.org/content/early/2015/10/08/028696.full.pdf" + , journal = "bioRxiv" + , textVersion = paste( "clonotypeR--high throughput analysis of T cell antigen receptor sequences." + , "Charles Plessy, Encarnita Mariotti-Ferrandiz, Ri-Ichiroh Manabe, Shohei Hori." + , "bioRxiv doi: http://dx.doi.org/10.1101/028696" + , "This article is a preprint and has not been peer-reviewed." + ) + )
CDJtools
diff --git a/index.mdwn b/index.mdwn index 428ac8e..4745394 100644 --- a/index.mdwn +++ b/index.mdwn @@ -38,8 +38,9 @@ to try alternative solutions, you can have a look at [[IMGTHighV-QUEST|http://www.imgt.org/IMGTindex/IMGTHighV-QUEST.html]], [Decombinator](http://pubmed.gov/23303508 "Bioinformatics. 2013 Mar 1;29(5):542-50"), [MiTCR](http://mitcr.milaboratory.com/), -[MIGEC](http://migec.readthedocs.org/en/latest/cdrblast.html), or -[LymAnalyzer](http://nar.oxfordjournals.org/content/44/4/e31.full). +[MIGEC](http://migec.readthedocs.org/en/latest/cdrblast.html), +[LymAnalyzer](http://nar.oxfordjournals.org/content/44/4/e31.full), or +[VDJtools](https://github.com/mikessh/vdjtools). See also the [OMICtool](http://omictools.com/rep-seq-c424-p1.html) website for a longer list of repertoire tools. *clonotypeR* is placed in the [public domain](http://creativecommons.org/publicdomain/zero/1.0/).
List LymAnalyzer, but did not test.
diff --git a/index.mdwn b/index.mdwn index 82bf104..428ac8e 100644 --- a/index.mdwn +++ b/index.mdwn @@ -37,8 +37,9 @@ RIKEN about shortcomings, limitations, or possible developments. If you need to try alternative solutions, you can have a look at [[IMGTHighV-QUEST|http://www.imgt.org/IMGTindex/IMGTHighV-QUEST.html]], [Decombinator](http://pubmed.gov/23303508 "Bioinformatics. 2013 Mar 1;29(5):542-50"), -[MiTCR](http://mitcr.milaboratory.com/), or -[MIGEC](http://migec.readthedocs.org/en/latest/cdrblast.html). +[MiTCR](http://mitcr.milaboratory.com/), +[MIGEC](http://migec.readthedocs.org/en/latest/cdrblast.html), or +[LymAnalyzer](http://nar.oxfordjournals.org/content/44/4/e31.full). See also the [OMICtool](http://omictools.com/rep-seq-c424-p1.html) website for a longer list of repertoire tools. *clonotypeR* is placed in the [public domain](http://creativecommons.org/publicdomain/zero/1.0/).
Use ikiwiki syntax for image display and plain Markdown as fallback just in case.
diff --git a/references/README.mdwn b/references/README.mdwn index a256479..d357a9d 100644 --- a/references/README.mdwn +++ b/references/README.mdwn @@ -9,8 +9,10 @@ The references sequences are [TRA@.gb][Mmus_TRA], [TRB@.gb][Mmus_TRB] and files with full information from the NCBI's website, select _Show sequence_ and _GenBank (full)_ as shown in the panels below. - - +[[!img NCBI_Show_sequence.png alt='How to select "Show sequence"' link='no']] + +[[!img NCBI_Save_GenBank_full.png alt='How to select "GenBank (full)"' link='no']] + The *V*, *(D)*, *J* and *C* segments were extracted with the command `make gb2fa`, wich uses the the [extractfeat][] program of the EMBOSS package.
Updated from RefSeq.
No notable changes for clonotpyeR.
No notable changes for clonotpyeR.
diff --git a/references/TRG@.gb b/references/TRG@.gb
index 9d48faf..ff43dad 100644
--- a/references/TRG@.gb
+++ b/references/TRG@.gb
@@ -1,4 +1,4 @@
-LOCUS NG_007033 179435 bp DNA linear CON 03-NOV-2013
+LOCUS NG_007033 179435 bp DNA linear CON 29-DEC-2013
DEFINITION Mus musculus T cell receptor gamma chain (Tcrg) on chromosome 13.
ACCESSION NG_007033
VERSION NG_007033.1 GI:159120306
@@ -46,14 +46,15 @@ REFERENCE 4 (bases 1 to 179435)
REMARK GeneRIF: Gamma delta receptor loss in T-cells are involved in hair
cycling defects.
REFERENCE 5 (bases 1 to 179435)
- AUTHORS Jeong,S.P., Kang,J.A. and Park,S.G.
- TITLE Intestinal intraepithelial TCRgammadelta(+) T cells are activated
- by normal commensal bacteria
- JOURNAL J. Microbiol. 50 (5), 837-841 (2012)
- PUBMED 23124753
- REMARK GeneRIF: TCRgammadelta(+) T cell population attached to the
- intestinal lumen is constitutively activated by normal commensal
- bacteria.
+ AUTHORS Laird,R.M., Wolf,B.J., Princiotta,M.F. and Hayes,S.M.
+ TITLE gammadelta T cells acquire effector fates in the thymus and
+ differentiate into cytokine-producing effectors in a Listeria model
+ of infection independently of CD28 costimulation
+ JOURNAL PLoS ONE 8 (5), E63178 (2013)
+ PUBMED 23671671
+ REMARK GeneRIF: Data indicate that CD28 is dispensable for gammadelta
+ effector T cell development and differentiation.
+ Publication Status: Online-Only
REFERENCE 6 (bases 1 to 179435)
AUTHORS Johnson,K.R. and Davisson,M.T.
TITLE A multipoint genetic linkage map of mouse chromosome 18
@@ -114,8 +115,8 @@ COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
publications that are available for this gene. Please see the Gene
record to access additional publications.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
- 1-61826 AC122849.4 140943-202768
- 61827-179435 AC146604.5 30325-147933
+ 1-61826 AC071805.4 140943-202768
+ 61827-179435 AC131072.5 30325-147933
FEATURES Location/Qualifiers
source 1..179435
/organism="Mus musculus"
@@ -128,14 +129,14 @@ FEATURES Location/Qualifiers
/gene_synonym="TCRGV1S1; TCRGV2S1; TCRGV3S1; TCRGV5S3"
/note="T cell receptor gamma chain"
/db_xref="GeneID:110067"
- /db_xref="MGI:98623"
+ /db_xref="MGI:MGI:98623"
gene 501..951
/gene="Tcrg-V7"
/gene_synonym="TRGV7; Vg7"
/note="T cell receptor gamma, variable 7"
/db_xref="GeneID:21641"
/db_xref="IMGT/GENE-DB:TRGV7"
- /db_xref="MGI:98637"
+ /db_xref="MGI:MGI:98637"
CDS join(501..543,645..951)
/gene="Tcrg-V7"
/gene_synonym="TRGV7; Vg7"
@@ -143,7 +144,7 @@ FEATURES Location/Qualifiers
/codon_start=1
/db_xref="GeneID:21641"
/db_xref="IMGT/GENE-DB:TRGV7"
- /db_xref="MGI:98637"
+ /db_xref="MGI:MGI:98637"
V_segment join(501..543,645..951)
/gene="Tcrg-V7"
/gene_synonym="TRGV7; Vg7"
@@ -154,7 +155,7 @@ FEATURES Location/Qualifiers
/note="T cell receptor gamma, variable 4"
/db_xref="GeneID:21638"
/db_xref="IMGT/GENE-DB:TRGV4"
- /db_xref="MGI:98634"
+ /db_xref="MGI:MGI:98634"
CDS join(7440..7551,7659..7965)
/gene="Tcrg-V4"
/gene_synonym="AI528624; TRGV4; Vg4"
@@ -162,7 +163,7 @@ FEATURES Location/Qualifiers
/codon_start=1
/db_xref="GeneID:21638"
/db_xref="IMGT/GENE-DB:TRGV4"
- /db_xref="MGI:98634"
+ /db_xref="MGI:MGI:98634"
V_segment join(7440..7551,7659..7965)
/gene="Tcrg-V4"
/gene_synonym="AI528624; TRGV4; Vg4"
@@ -173,7 +174,7 @@ FEATURES Location/Qualifiers
/note="T cell receptor gamma, variable 6"
/db_xref="GeneID:21640"
/db_xref="IMGT/GENE-DB:TRGV6"
- /db_xref="MGI:98636"
+ /db_xref="MGI:MGI:98636"
CDS join(12827..12920,13077..13388)
/gene="Tcrg-V6"
/gene_synonym="TRGV6"
@@ -181,7 +182,7 @@ FEATURES Location/Qualifiers
/codon_start=1
/db_xref="GeneID:21640"
/db_xref="IMGT/GENE-DB:TRGV6"
- /db_xref="MGI:98636"
+ /db_xref="MGI:MGI:98636"
V_segment join(12827..12920,13077..13388)
/gene="Tcrg-V6"
/gene_synonym="TRGV6"
@@ -192,7 +193,7 @@ FEATURES Location/Qualifiers
/note="T cell receptor gamma, variable 5"
/db_xref="GeneID:21639"
/db_xref="IMGT/GENE-DB:TRGV5"
- /db_xref="MGI:98635"
+ /db_xref="MGI:MGI:98635"
CDS join(14737..14779,14887..15184)
/gene="Tcrg-V5"
/gene_synonym="TRGV5"
@@ -200,7 +201,7 @@ FEATURES Location/Qualifiers
/codon_start=1
/db_xref="GeneID:21639"
/db_xref="IMGT/GENE-DB:TRGV5"
- /db_xref="MGI:98635"
+ /db_xref="MGI:MGI:98635"
V_segment join(14737..14779,14887..15184)
/gene="Tcrg-V5"
/gene_synonym="TRGV5"
@@ -211,7 +212,7 @@ FEATURES Location/Qualifiers
/note="T cell receptor gamma joining 1"
/db_xref="GeneID:100126431"
/db_xref="IMGT/GENE-DB:TRGJ1"
- /db_xref="MGI:4440480"
+ /db_xref="MGI:MGI:4440480"
CDS 32802..32861
/gene="Trgj1"
/gene_synonym="Gm17003"
@@ -219,7 +220,7 @@ FEATURES Location/Qualifiers
/codon_start=1
/db_xref="GeneID:100126431"
/db_xref="IMGT/GENE-DB:TRGJ1"
- /db_xref="MGI:4440480"
+ /db_xref="MGI:MGI:4440480"
J_segment 32802..32861
/gene="Trgj1"
/gene_synonym="Gm17003"
@@ -230,7 +231,7 @@ FEATURES Location/Qualifiers
/note="T cell receptor gamma, constant 1"
/db_xref="GeneID:107573"
/db_xref="IMGT/GENE-DB:TRGC1"
- /db_xref="MGI:98625"
+ /db_xref="MGI:MGI:98625"
CDS join(36562..36891,38323..38367,38935..39077)
/gene="Tcrg-C1"
/gene_synonym="Cgamma1; Gm17004; TRGC1"
@@ -238,7 +239,7 @@ FEATURES Location/Qualifiers
/codon_start=1
/db_xref="GeneID:107573"
/db_xref="IMGT/GENE-DB:TRGC1"
- /db_xref="MGI:98625"
+ /db_xref="MGI:MGI:98625"
C_region join(36562..36891,38323..38367,38935..39077)
/gene="Tcrg-C1"
/gene_synonym="Cgamma1; Gm17004; TRGC1"
@@ -248,7 +249,8 @@ FEATURES Location/Qualifiers
/gene_synonym="Cgamma1; Gm17004; TRGC1"
/standard_name="PMC156147P8"
/db_xref="UniSTS:271385"
- enhancer 41876..42875
+ regulatory 41876..42875
+ /regulatory_class="enhancer"
/gene="Tcrg"
/gene_synonym="TCRGV1S1; TCRGV2S1; TCRGV3S1; TCRGV5S3"
/note="gamma 1 enhancer"
@@ -258,7 +260,7 @@ FEATURES Location/Qualifiers
/note="T cell receptor gamma, variable 3"
/db_xref="GeneID:21637"
/db_xref="IMGT/GENE-DB:TRGV3"
- /db_xref="MGI:98633"
+ /db_xref="MGI:MGI:98633"
CDS join(65304..65349,65454..65760)
/gene="Tcrg-V3"
/gene_synonym="TCRGV5S3; TRGV3; vgamma3"
@@ -266,7 +268,7 @@ FEATURES Location/Qualifiers
/codon_start=1
/db_xref="GeneID:21637"
/db_xref="IMGT/GENE-DB:TRGV3"
- /db_xref="MGI:98633"
+ /db_xref="MGI:MGI:98633"
V_segment join(65304..65349,65454..65760)
/gene="Tcrg-V3"
/gene_synonym="TCRGV5S3; TRGV3; vgamma3"
@@ -277,7 +279,7 @@ FEATURES Location/Qualifiers
/note="T cell receptor gamma joining 3"
/db_xref="GeneID:100126432"
/db_xref="IMGT/GENE-DB:TRGJ3"
- /db_xref="MGI:4439528"
+ /db_xref="MGI:MGI:4439528"
CDS 79576..79635
/gene="Trgj3"
/gene_synonym="Gm16604"
@@ -285,7 +287,7 @@ FEATURES Location/Qualifiers
/codon_start=1
(Diff truncated)
Updated TRB@ locus from RefSeq.
Notable change: Trbv31 sequence corrected (following ticket 16738599
submitted by me)
Notable change: Trbv31 sequence corrected (following ticket 16738599
submitted by me)
diff --git a/references/TRB@.gb b/references/TRB@.gb
index 0f9255e..f4d8b3c 100644
--- a/references/TRB@.gb
+++ b/references/TRB@.gb
@@ -1,4 +1,4 @@
-LOCUS NG_006980 668076 bp DNA linear CON 05-NOV-2013
+LOCUS NG_006980 668076 bp DNA linear CON 05-NOV-2015
DEFINITION Mus musculus T cell receptor beta chain (Tcrb) on chromosome 6.
ACCESSION NG_006980
VERSION NG_006980.1 GI:158037406
@@ -9,74 +9,88 @@ SOURCE Mus musculus (house mouse)
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;
Sciurognathi; Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE 1 (bases 1 to 668076)
- AUTHORS Hess,C., Winkler,A., Lorenz,A.K., Holecska,V., Blanchard,V.,
- Eiglmeier,S., Schoen,A.L., Bitterling,J., Stoehr,A.D., Petzold,D.,
- Schommartz,T., Mertes,M.M., Schoen,C.T., Tiburzy,B., Herrmann,A.,
- Kohl,J., Manz,R.A., Madaio,M.P., Berger,M., Wardemann,H. and
- Ehlers,M.
- TITLE T cell-independent B cell activation induces immunosuppressive
- sialylated IgG antibodies
- JOURNAL J. Clin. Invest. 123 (9), 3788-3796 (2013)
- PUBMED 23979161
+ AUTHORS Mallis RJ, Bai K, Arthanari H, Hussey RE, Handley M, Li Z,
+ Chingozha L, Duke-Cohan JS, Lu H, Wang JH, Zhu C, Wagner G and
+ Reinherz EL.
+ TITLE Pre-TCR ligand binding impacts thymocyte development before
+ alphabetaTCR expression
+ JOURNAL Proc. Natl. Acad. Sci. U.S.A. 112 (27), 8373-8378 (2015)
+ PUBMED 26056289
+ REMARK GeneRIF: Data show that the pre-T-cell receptor (preTCR), a
+ pTalpha-beta heterodimer appearing before alphabetaTCR expression,
+ directs initial phase of repertoire selection.
REFERENCE 2 (bases 1 to 668076)
- AUTHORS Hickey,A.J., Lin,J.S., Kummer,L.W., Szaba,F.M., Duso,D.K.,
- Tighe,M., Parent,M.A. and Smiley,S.T.
- TITLE Intranasal prophylaxis with CpG oligodeoxynucleotide can protect
- against Yersinia pestis infection
- JOURNAL Infect. Immun. 81 (6), 2123-2132 (2013)
- PUBMED 23545300
+ AUTHORS Bergot AS, Chaara W, Ruggiero E, Mariotti-Ferrandiz E, Dulauroy S,
+ Schmidt M, von Kalle C, Six A and Klatzmann D.
+ TITLE TCR sequences and tissue distribution discriminate the subsets of
+ naive and activated/memory Treg cells in mice
+ JOURNAL Eur. J. Immunol. 45 (5), 1524-1534 (2015)
+ PUBMED 25726757
+ REMARK GeneRIF: in deep- versus superficial lymph nodes, TCR-beta deep
+ sequencing revealed diversified naive Treg-cell and
+ activated-memory Treg-cell repertoires
REFERENCE 3 (bases 1 to 668076)
- AUTHORS Archer,N.K., Harro,J.M. and Shirtliff,M.E.
- TITLE Clearance of Staphylococcus aureus nasal carriage is T cell
- dependent and mediated through interleukin-17A expression and
- neutrophil influx
- JOURNAL Infect. Immun. 81 (6), 2070-2075 (2013)
- PUBMED 23529621
+ AUTHORS Boudil A, Matei IR, Shih HY, Bogdanoski G, Yuan JS, Chang SG,
+ Montpellier B, Kowalski PE, Voisin V, Bashir S, Bader GD, Krangel
+ MS and Guidos CJ.
+ TITLE IL-7 coordinates proliferation, differentiation and Tcra
+ recombination during thymocyte beta-selection
+ JOURNAL Nat. Immunol. 16 (4), 397-405 (2015)
+ PUBMED 25729925
+ REMARK GeneRIF: IL-7 critically acts cooperatively with signaling via the
+ pre-TCR and Notch1 to coordinate proliferation, differentiation and
+ TCRalpha recombination during beta-selection.
REFERENCE 4 (bases 1 to 668076)
- AUTHORS Larson,R.P., Comeau,M.R. and Ziegler,S.F.
- TITLE Cutting edge: allergen-specific CD4 T cells respond indirectly to
- thymic stromal lymphopoietin to promote allergic responses in the
- skin
- JOURNAL J. Immunol. 190 (9), 4474-4477 (2013)
- PUBMED 23543759
+ AUTHORS Guenova E, Skabytska Y, Hoetzenecker W, Weindl G, Sauer K, Tham M,
+ Kim KW, Park JH, Seo JH, Ignatova D, Cozzio A, Levesque MP, Volz T,
+ Koberle M, Kaesler S, Thomas P, Mailhammer R, Ghoreschi K, Schakel
+ K, Amarov B, Eichner M, Schaller M, Clark RA, Rocken M and
+ Biedermann T.
+ TITLE IL-4 abrogates T(H)17 cell-mediated inflammation by selective
+ silencing of IL-23 in antigen-presenting cells
+ JOURNAL Proc. Natl. Acad. Sci. U.S.A. 112 (7), 2163-2168 (2015)
+ PUBMED 25646481
REFERENCE 5 (bases 1 to 668076)
- AUTHORS Brady,B.L., Rupp,L.J. and Bassing,C.H.
- TITLE Requirement for dicer in survival of proliferating thymocytes
- experiencing DNA double-strand breaks
- JOURNAL J. Immunol. 190 (7), 3256-3266 (2013)
- PUBMED 23427252
+ AUTHORS Khairnar V, Duhan V, Maney SK, Honke N, Shaabani N, Pandyra AA,
+ Seifert M, Pozdeev V, Xu HC, Sharma P, Baldin F, Marquardsen F,
+ Merches K, Lang E, Kirschning C, Westendorf AM, Haussinger D, Lang
+ F, Dittmer U, Kuppers R, Recher M, Hardt C, Scheffrahn I,
+ Beauchemin N, Gothert JR, Singer BB, Lang PA and Lang KS.
+ TITLE CEACAM1 induces B-cell survival and is essential for protective
+ antiviral antibody production
+ JOURNAL Nat Commun 6, 6217 (2015)
+ PUBMED 25692415
+ REMARK Publication Status: Online-Only
REFERENCE 6 (bases 1 to 668076)
- AUTHORS Acha-Orbea,H., Scarpellino,L., Shakhov,A.N., Held,W. and
- MacDonald,H.R.
+ AUTHORS Acha-Orbea H, Scarpellino L, Shakhov AN, Held W and MacDonald HR.
TITLE Inhibition of mouse mammary tumor virus-induced T cell responses in
vivo by antibodies to an open reading frame protein
JOURNAL J. Exp. Med. 176 (6), 1769-1772 (1992)
PUBMED 1334118
REFERENCE 7 (bases 1 to 668076)
- AUTHORS Mombaerts,P., Clarke,A.R., Rudnicki,M.A., Iacomini,J., Itohara,S.,
- Lafaille,J.J., Wang,L., Ichikawa,Y., Jaenisch,R., Hooper,M.L. et
- al.
+ AUTHORS Mombaerts P, Clarke AR, Rudnicki MA, Iacomini J, Itohara S,
+ Lafaille JJ, Wang L, Ichikawa Y, Jaenisch R, Hooper ML et al.
TITLE Mutations in T-cell antigen receptor genes alpha and beta block
thymocyte development at different stages
JOURNAL Nature 360 (6401), 225-231 (1992)
PUBMED 1359428
REMARK Erratum:[Nature 1992 Dec 3;360(6403):491]
REFERENCE 8 (bases 1 to 668076)
- AUTHORS Ossendorp,F., Jacobs,H., van der Horst,G., de Vries,E., Berns,A.
- and Borst,J.
+ AUTHORS Ossendorp F, Jacobs H, van der Horst G, de Vries E, Berns A and
+ Borst J.
TITLE T cell receptor-alpha beta lacking the beta-chain V domain can be
expressed at the cell surface but prohibits T cell maturation
JOURNAL J. Immunol. 148 (12), 3714-3722 (1992)
PUBMED 1351085
REFERENCE 9 (bases 1 to 668076)
- AUTHORS Suzuki,M., Koseki,H., Mizutani,Y., Kuribayashi,K., Kanno,M. and
- Taniguchi,M.
+ AUTHORS Suzuki M, Koseki H, Mizutani Y, Kuribayashi K, Kanno M and
+ Taniguchi M.
TITLE Expansion of murine T cells bearing a unique T cell receptor
beta-chain in Friend virus-induced tumor in situ
JOURNAL J. Immunol. 148 (9), 2968-2973 (1992)
PUBMED 1374106
REFERENCE 10 (bases 1 to 668076)
- AUTHORS Waters,S.H., O'Neil,J.J., Melican,D.T. and Appel,M.C.
+ AUTHORS Waters SH, O'Neil JJ, Melican DT and Appel MC.
TITLE Multiple TCR V beta usage by infiltrates of young NOD mouse islets
of Langerhans. A polymerase chain reaction analysis
JOURNAL Diabetes 41 (3), 308-312 (1992)
@@ -114,13 +128,13 @@ COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
publications that are available for this gene. Please see the Gene
record to access additional publications.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
- 1-40285 AC161887.5 187467-227751
- 40286-148984 AC161768.25 87370-196068
- 148985-267619 AC153851.27 99220-217854
- 267620-433004 AC125228.4 96216-261600
- 433005-559515 AC158659.6 1-126511 c
- 559516-635734 AC153854.7 105046-181264
- 635735-668076 AC117678.16 48698-81039
+ 1-40285 AC157861.5 187467-227751
+ 40286-148984 AC131072.25 87370-196068
+ 148985-267619 AC131072.27 99220-217854
+ 267620-433004 AC065536.4 96216-261600
+ 433005-559515 AC131072.6 1-126511 c
+ 559516-635734 AC131072.7 105046-181264
+ 635735-668076 AC065536.16 48698-81039
FEATURES Location/Qualifiers
source 1..668076
/organism="Mus musculus"
@@ -133,14 +147,14 @@ FEATURES Location/Qualifiers
/gene_synonym="TCRbeta; Tib"
/note="T cell receptor beta chain"
/db_xref="GeneID:21577"
- /db_xref="MGI:98578"
+ /db_xref="MGI:MGI:98578"
gene 502..1091
/gene="Trbv1"
/gene_synonym="621968; Gm6273; Tcrb-V2; TCRBV2S1"
/note="T cell receptor beta, variable 1"
/db_xref="GeneID:621968"
/db_xref="IMGT/GENE-DB:TRBV1"
- /db_xref="MGI:98594"
+ /db_xref="MGI:MGI:98594"
CDS join(502..556,797..1091)
/gene="Trbv1"
/gene_synonym="621968; Gm6273; Tcrb-V2; TCRBV2S1"
@@ -148,7 +162,7 @@ FEATURES Location/Qualifiers
/codon_start=1
/db_xref="GeneID:621968"
/db_xref="IMGT/GENE-DB:TRBV1"
- /db_xref="MGI:98594"
+ /db_xref="MGI:MGI:98594"
V_segment join(502..556,797..1091)
/gene="Trbv1"
/gene_synonym="621968; Gm6273; Tcrb-V2; TCRBV2S1"
@@ -158,7 +172,7 @@ FEATURES Location/Qualifiers
/gene_synonym="1700020H15; Tryx3"
/note="protease, serine 58"
/db_xref="GeneID:232717"
- /db_xref="MGI:3608323"
+ /db_xref="MGI:MGI:3608323"
mRNA complement(join(4468..4717,4801..4940,6511..6767,
6933..7071,9260..9344,9478..9593))
/gene="Prss58"
@@ -167,7 +181,7 @@ FEATURES Location/Qualifiers
/transcript_id="NM_175020.3"
/db_xref="GI:146198660"
(Diff truncated)
Screen capture showing how to export the GenBank files.
diff --git a/references/NCBI_Save_GenBank_full.png b/references/NCBI_Save_GenBank_full.png new file mode 100644 index 0000000..9f7a6bd Binary files /dev/null and b/references/NCBI_Save_GenBank_full.png differ diff --git a/references/NCBI_Show_sequence.png b/references/NCBI_Show_sequence.png new file mode 100644 index 0000000..22815c4 Binary files /dev/null and b/references/NCBI_Show_sequence.png differ diff --git a/references/README.mdwn b/references/README.mdwn index 8f7211a..a256479 100644 --- a/references/README.mdwn +++ b/references/README.mdwn @@ -5,9 +5,15 @@ Mus musculus ------------ The references sequences are [TRA@.gb][Mmus_TRA], [TRB@.gb][Mmus_TRB] and -[TRG@.gb][Mmus_TRG], downloaded in GenBank format from [RefSeq][]. The *V*, *(D)*, *J* and *C* segments were -extracted with the command `make gb2fa`, wich uses the the [extractfeat][] -program of the EMBOSS package. +[TRG@.gb][Mmus_TRG], downloaded in GenBank format from [RefSeq][]. To save the +files with full information from the NCBI's website, select _Show sequence_ and +_GenBank (full)_ as shown in the panels below. + + + + +The *V*, *(D)*, *J* and *C* segments were extracted with the command `make +gb2fa`, wich uses the the [extractfeat][] program of the EMBOSS package. This directory contains *V* and *J* segments aligned on conserved motifs in the files [[V.fa]] and [[J.fa]]. These alignments were made by hand using [[SeaView|doc/seaview]] and
Updated mouse TRA@ record.
Notable change: "Trav21/dv12" is renamed "Trav21-dv12".
Notable change: "Trav21/dv12" is renamed "Trav21-dv12".
diff --git a/references/TRA@.gb b/references/TRA@.gb
index f0e1f64..b51e0b6 100644
--- a/references/TRA@.gb
+++ b/references/TRA@.gb
@@ -1,4 +1,4 @@
-LOCUS NG_007044 1797232 bp DNA linear CON 08-JUL-2013
+LOCUS NG_007044 1797232 bp DNA linear CON 30-SEP-2015
DEFINITION Mus musculus T cell receptor alpha delta locus (Tcra/tcrd@) on
chromosome 14.
ACCESSION NG_007044
@@ -10,7 +10,7 @@ SOURCE Mus musculus (house mouse)
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;
Sciurognathi; Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE 1 (bases 1 to 1797232)
- AUTHORS Takeshita,S., Toda,M. and Yamagishi,H.
+ AUTHORS Takeshita S, Toda M and Yamagishi H.
TITLE Excision products of the T cell receptor gene support a progressive
rearrangement model of the alpha/delta locus
JOURNAL EMBO J. 8 (11), 3261-3270 (1989)
@@ -97,14 +97,14 @@ FEATURES Location/Qualifiers
/gene_synonym="Tcralpha"
/note="T cell receptor alpha chain"
/db_xref="GeneID:21473"
- /db_xref="MGI:98553"
+ /db_xref="MGI:MGI:98553"
gene 501..1410
/gene="Trav1"
/gene_synonym="Gm13987; OTTMUSG00000015242"
/note="T cell receptor alpha variable 1"
/db_xref="GeneID:627171"
/db_xref="IMGT/GENE-DB:TRAV1"
- /db_xref="MGI:3651476"
+ /db_xref="MGI:MGI:3651476"
CDS join(501..549,1128..1410)
/gene="Trav1"
/gene_synonym="Gm13987; OTTMUSG00000015242"
@@ -112,7 +112,7 @@ FEATURES Location/Qualifiers
/codon_start=1
/db_xref="GeneID:627171"
/db_xref="IMGT/GENE-DB:TRAV1"
- /db_xref="MGI:3651476"
+ /db_xref="MGI:MGI:3651476"
V_segment join(501..549,1128..1410)
/gene="Trav1"
/gene_synonym="Gm13987; OTTMUSG00000015242"
@@ -122,7 +122,7 @@ FEATURES Location/Qualifiers
/gene_synonym="MOR244-3; Mor83; Or83"
/note="olfactory receptor 1509"
/db_xref="GeneID:57271"
- /db_xref="MGI:3031343"
+ /db_xref="MGI:MGI:3031343"
mRNA 22927..23936
/gene="Olfr1509"
/gene_synonym="MOR244-3; Mor83; Or83"
@@ -130,7 +130,7 @@ FEATURES Location/Qualifiers
/transcript_id="NM_020514.2"
/db_xref="GI:282394046"
/db_xref="GeneID:57271"
- /db_xref="MGI:3031343"
+ /db_xref="MGI:MGI:3031343"
STS 22927..23936
/gene="Olfr1509"
/gene_synonym="MOR244-3; Mor83; Or83"
@@ -146,7 +146,7 @@ FEATURES Location/Qualifiers
/db_xref="GI:282394047"
/db_xref="CCDS:CCDS27060.1"
/db_xref="GeneID:57271"
- /db_xref="MGI:3031343"
+ /db_xref="MGI:MGI:3031343"
/translation="MGALNQTRVTEFIFLGLTDNWVLEILFFVPFTVTYMLTLLGNFL
IVVTIVFTPRLHNPMYFFLSNLSFIDICHSSVTVPKMLEGLLLERKTISFDNCIAQLF
FLHLFACSEIFLLTIMAYDRYVAICIPLHYSNVMNMKVCVQLVFALWLGGTIHSLVQT
@@ -163,7 +163,7 @@ FEATURES Location/Qualifiers
/gene_synonym="Mor10; MOR244-2; MOR244-4; Or10"
/note="olfactory receptor 1508"
/db_xref="GeneID:57270"
- /db_xref="MGI:3031342"
+ /db_xref="MGI:MGI:3031342"
mRNA complement(join(35255..36556,39430..39995))
/gene="Olfr1508"
/gene_synonym="Mor10; MOR244-2; MOR244-4; Or10"
@@ -172,7 +172,7 @@ FEATURES Location/Qualifiers
/transcript_id="NM_020513.2"
/db_xref="GI:112821657"
/db_xref="GeneID:57270"
- /db_xref="MGI:3031342"
+ /db_xref="MGI:MGI:3031342"
STS 35562..36634
/gene="Tcra"
/gene_synonym="Tcralpha"
@@ -188,7 +188,7 @@ FEATURES Location/Qualifiers
/db_xref="GI:10048450"
/db_xref="CCDS:CCDS27061.1"
/db_xref="GeneID:57270"
- /db_xref="MGI:3031342"
+ /db_xref="MGI:MGI:3031342"
/translation="MEKAVLINETSVMSFRLTGLSTNPLVQMAVFFIFLIFYVLTLVG
NILIVITIIYDRRLHTPMYFFLSNLSFIDVCHSTVTVPKMLSDTFSEEKLISFDACVV
QMFFLHLFACTEIFLLTVMAYDRYVAICKPLQYMTIMNWKVCMMLAAALWTGGTIHSI
@@ -204,7 +204,7 @@ FEATURES Location/Qualifiers
/gene_synonym="MOR244-1; Mor28; Or28"
/note="olfactory receptor 1507"
/db_xref="GeneID:57269"
- /db_xref="MGI:3031341"
+ /db_xref="MGI:MGI:3031341"
mRNA complement(join(62469..63506,67663..68229))
/gene="Olfr1507"
/gene_synonym="MOR244-1; Mor28; Or28"
@@ -212,7 +212,7 @@ FEATURES Location/Qualifiers
/transcript_id="NM_001170918.1"
/db_xref="GI:283135127"
/db_xref="GeneID:57269"
- /db_xref="MGI:3031341"
+ /db_xref="MGI:MGI:3031341"
mRNA complement(62469..63580)
/gene="Olfr1507"
/gene_synonym="MOR244-1; Mor28; Or28"
@@ -220,7 +220,7 @@ FEATURES Location/Qualifiers
/transcript_id="NM_020512.2"
/db_xref="GI:283135125"
/db_xref="GeneID:57269"
- /db_xref="MGI:3031341"
+ /db_xref="MGI:MGI:3031341"
STS 62469..63580
/gene="Tcra"
/gene_synonym="Tcralpha"
@@ -236,7 +236,7 @@ FEATURES Location/Qualifiers
/db_xref="GI:283135126"
/db_xref="CCDS:CCDS27062.1"
/db_xref="GeneID:57269"
- /db_xref="MGI:3031341"
+ /db_xref="MGI:MGI:3031341"
/translation="MEKAVLINQTSVMSFRLTGLSTNPKVQMAIFFIFLIFYVLTLVG
NILIVITIIHDHRLHTPMYFFLSNLSFIDVCHSTVTVPKMLSDTFSEEKLISFDDCVV
QIFFLHLFACTEIFLLTVMAYDRYVAICKPLRYMTIMNWKVCMVLGGAMWTAGTIHSI
@@ -254,7 +254,7 @@ FEATURES Location/Qualifiers
/db_xref="GI:283135128"
/db_xref="CCDS:CCDS27062.1"
/db_xref="GeneID:57269"
- /db_xref="MGI:3031341"
+ /db_xref="MGI:MGI:3031341"
/translation="MEKAVLINQTSVMSFRLTGLSTNPKVQMAIFFIFLIFYVLTLVG
NILIVITIIHDHRLHTPMYFFLSNLSFIDVCHSTVTVPKMLSDTFSEEKLISFDDCVV
QIFFLHLFACTEIFLLTVMAYDRYVAICKPLRYMTIMNWKVCMVLGGAMWTAGTIHSI
@@ -272,14 +272,14 @@ FEATURES Location/Qualifiers
/note="predicted gene 9537"
/pseudo
/db_xref="GeneID:671621"
- /db_xref="MGI:3779947"
+ /db_xref="MGI:MGI:3779947"
gene 111186..113410
/gene="Gm7122"
/gene_synonym="EG633692"
/note="predicted pseudogene 7122"
/pseudo
/db_xref="GeneID:633692"
- /db_xref="MGI:3644290"
+ /db_xref="MGI:MGI:3644290"
gene 139827..140587
/gene="Trav2"
/gene_synonym="ENSMUSG00000072561; ENSMUSG00000076759;
@@ -287,7 +287,7 @@ FEATURES Location/Qualifiers
/note="T cell receptor alpha variable 2"
/db_xref="GeneID:100042372"
/db_xref="IMGT/GENE-DB:TRAV2"
- /db_xref="MGI:3642679"
+ /db_xref="MGI:MGI:3642679"
CDS join(139827..139866,140298..140587)
/gene="Trav2"
/gene_synonym="ENSMUSG00000072561; ENSMUSG00000076759;
@@ -296,7 +296,7 @@ FEATURES Location/Qualifiers
/codon_start=1
/db_xref="GeneID:100042372"
/db_xref="IMGT/GENE-DB:TRAV2"
- /db_xref="MGI:3642679"
+ /db_xref="MGI:MGI:3642679"
V_segment join(139827..139866,140298..140587)
/gene="Trav2"
/gene_synonym="ENSMUSG00000072561; ENSMUSG00000076759;
@@ -308,7 +308,7 @@ FEATURES Location/Qualifiers
/note="T cell receptor alpha variable 3-1"
/db_xref="GeneID:667441"
/db_xref="IMGT/GENE-DB:TRAV3-1"
- /db_xref="MGI:3644489"
+ /db_xref="MGI:MGI:3644489"
CDS join(153296..153421,153457..153747)
/gene="Trav3-1"
/gene_synonym="EG667441; Gm8635"
@@ -316,7 +316,7 @@ FEATURES Location/Qualifiers
/codon_start=1
/db_xref="GeneID:667441"
/db_xref="IMGT/GENE-DB:TRAV3-1"
- /db_xref="MGI:3644489"
+ /db_xref="MGI:MGI:3644489"
V_segment join(153296..153421,153457..153747)
/gene="Trav3-1"
/gene_synonym="EG667441; Gm8635"
@@ -328,7 +328,7 @@ FEATURES Location/Qualifiers
/pseudo
/db_xref="GeneID:100042384"
(Diff truncated)
Bumped version number of all packages after creation of 3.2 branch.
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@109592 bc3139a8-67e5-0310-9ffc-ced21a209358
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@109592 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/DESCRIPTION b/DESCRIPTION index 83ba17e..cda02f5 100644 --- a/DESCRIPTION +++ b/DESCRIPTION @@ -1,7 +1,7 @@ Package: clonotypeR Type: Package Title: High throughput analysis of T cell antigen receptor sequences -Version: 1.8.0 +Version: 1.9.0 Date: 2015-10-06 Author: Charles Plessy <plessy@riken.jp> Maintainer: Charles Plessy <plessy@riken.jp>
Bumped versions of all packages prior to creating 3.2 branch.
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@109589 bc3139a8-67e5-0310-9ffc-ced21a209358
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@109589 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/DESCRIPTION b/DESCRIPTION index b3405df..83ba17e 100644 --- a/DESCRIPTION +++ b/DESCRIPTION @@ -1,7 +1,7 @@ Package: clonotypeR Type: Package Title: High throughput analysis of T cell antigen receptor sequences -Version: 1.7.1 +Version: 1.8.0 Date: 2015-10-06 Author: Charles Plessy <plessy@riken.jp> Maintainer: Charles Plessy <plessy@riken.jp>
bioRxiv
diff --git a/doc/workflow.mdwn b/doc/workflow.mdwn index c8a42b0..90bea49 100644 --- a/doc/workflow.mdwn +++ b/doc/workflow.mdwn @@ -1,7 +1,7 @@ clonotypeR's workflow ===================== -This workflow summarises the different commands to run. Step-by-step examples using [[test data|doc/examples/with_test_data]] or the [[examples/GSE35626]] public dataset are also available for a more detailed explanation. +This workflow summarises the different commands to run. Step-by-step examples using [[test data|doc/examples/with_test_data]] or the [[examples/GSE35626]] public dataset are also available for a more detailed explanation. See also the preprint of our [application note deposited in bioRxiv](http://biorxiv.org/content/early/2015/10/08/028696). Data preparation in the command line ------------------------------------
bioRxiv
diff --git a/index.mdwn b/index.mdwn index 92fe6a2..82bf104 100644 --- a/index.mdwn +++ b/index.mdwn @@ -47,6 +47,7 @@ See also the [OMICtool](http://omictools.com/rep-seq-c424-p1.html) website for a ### Recent news + * October 2015: Application note preprint deposited in [bioRxiv](http://biorxiv.org/content/early/2015/10/08/028696). * October 2014: New stable version [1.4](http://www.bioconductor.org/packages/3.0/bioc/html/clonotypeR.html) released on Bioconductor. * 25 September 2014: version 1.3.2 compatible with EMBOSS 6.6.0.
Commit made by the Bioconductor Git-SVN bridge.
Commit id: 1ce65683a51bc2911528caeb7730a4d2da3ebfb9
Increment date and version number.
Commit id: 1f47faad987a4749d15e492a56aac53314ebde83
News for next stable release.
Commit id: ee840ec5011bd28ffd52e6a3732548008bb89077
Roxygen documentation.
Commit id: 8f337a5052bba588e27af72164be92596f547c84
Rstudio...
Commit id: 9b493ce40a9372ecde96e8ab694e52c60d701142
Show where to report bugs.
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@109224 bc3139a8-67e5-0310-9ffc-ced21a209358
Commit id: 1ce65683a51bc2911528caeb7730a4d2da3ebfb9
Increment date and version number.
Commit id: 1f47faad987a4749d15e492a56aac53314ebde83
News for next stable release.
Commit id: ee840ec5011bd28ffd52e6a3732548008bb89077
Roxygen documentation.
Commit id: 8f337a5052bba588e27af72164be92596f547c84
Rstudio...
Commit id: 9b493ce40a9372ecde96e8ab694e52c60d701142
Show where to report bugs.
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@109224 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/.Rbuildignore b/.Rbuildignore
index 36312b8..13929dd 100644
--- a/.Rbuildignore
+++ b/.Rbuildignore
@@ -9,3 +9,5 @@
Makefile
^references$
^scripts$
+^.*\.Rproj$
+^\.Rproj\.user$
diff --git a/.gitignore b/.gitignore
index edd4856..fcd14f2 100644
--- a/.gitignore
+++ b/.gitignore
@@ -1 +1,2 @@
.ikiwiki
+.Rproj.user
diff --git a/DESCRIPTION b/DESCRIPTION
index dbe503a..b3405df 100644
--- a/DESCRIPTION
+++ b/DESCRIPTION
@@ -1,8 +1,8 @@
Package: clonotypeR
Type: Package
Title: High throughput analysis of T cell antigen receptor sequences
-Version: 1.7.0
-Date: 2014-09-25
+Version: 1.7.1
+Date: 2015-10-06
Author: Charles Plessy <plessy@riken.jp>
Maintainer: Charles Plessy <plessy@riken.jp>
Description: High throughput analysis of T cell antigen receptor sequences
@@ -20,3 +20,4 @@ Suggests: BiocGenerics, edgeR, knitr, pvclust, RUnit, vegan
VignetteBuilder: knitr
Packaged: 2013-12-11 10:22:39 UTC; charles
biocViews: Sequencing
+BugReports: http://clonotyper.branchable.com/Bugs/
diff --git a/NEWS b/NEWS
index 4b9b4a2..1f8f401 100644
--- a/NEWS
+++ b/NEWS
@@ -1,3 +1,9 @@
+Changes in version 1.8.0
+
+NEW FEATURES
+
+ o Added a “private_clonotypes” function.
+
Changes in version 1.4.0
BUG FIXES
diff --git a/R/private_clonotypes.R b/R/private_clonotypes.R
index 48e28d8..e8eec4e 100644
--- a/R/private_clonotypes.R
+++ b/R/private_clonotypes.R
@@ -1,3 +1,19 @@
+#' private_clonotypes
+#'
+#' List clonotypes found exclusively in one library.
+#'
+#' @param ... Library names.
+#' @param data A clonotype table.
+#'
+#' @return A vector of clonotype names.
+#'
+#' @seealso \code{\link{clonotype_table}}
+#'
+#' @examples
+#' clonotypes <- read_clonotypes(system.file('extdata', 'clonotypes.txt.gz', package = "clonotypeR"))
+#' clonotypes <- clonotype_table(levels(clonotypes$lib), data=clonotypes)
+#' private_clonotypes("C", data=clonotypes)
+
private_clonotypes <- function (..., data) {
libs <- c(...)
@@ -8,7 +24,7 @@ if ( ! is.character(libs) ) stop (
)
if ( ! is.data.frame(data) ) stop (
- "Second argument must be a data frame of clonotypes."
+ "Data argument must be a data frame of clonotypes."
)
if ( FALSE %in% ( libs %in% colnames(data) ) ) stop (
diff --git a/man/private_clonotypes.Rd b/man/private_clonotypes.Rd
new file mode 100644
index 0000000..9fdd23b
--- /dev/null
+++ b/man/private_clonotypes.Rd
@@ -0,0 +1,28 @@
+% Generated by roxygen2 (4.1.1): do not edit by hand
+% Please edit documentation in R/private_clonotypes.R
+\name{private_clonotypes}
+\alias{private_clonotypes}
+\title{private_clonotypes}
+\usage{
+private_clonotypes(..., data)
+}
+\arguments{
+\item{...}{Library names.}
+
+\item{data}{A clonotype table.}
+}
+\value{
+A vector of clonotype names.
+}
+\description{
+List clonotypes found exclusively in one library.
+}
+\examples{
+clonotypes <- read_clonotypes(system.file('extdata', 'clonotypes.txt.gz', package = "clonotypeR"))
+clonotypes <- clonotype_table(levels(clonotypes$lib), data=clonotypes)
+private_clonotypes("C", data=clonotypes)
+}
+\seealso{
+\code{\link{clonotype_table}}
+}
+
Increment date and version number.
diff --git a/DESCRIPTION b/DESCRIPTION index 4e3e018..b3405df 100644 --- a/DESCRIPTION +++ b/DESCRIPTION @@ -1,8 +1,8 @@ Package: clonotypeR Type: Package Title: High throughput analysis of T cell antigen receptor sequences -Version: 1.7.0 -Date: 2014-09-25 +Version: 1.7.1 +Date: 2015-10-06 Author: Charles Plessy <plessy@riken.jp> Maintainer: Charles Plessy <plessy@riken.jp> Description: High throughput analysis of T cell antigen receptor sequences
News for next stable release.
diff --git a/NEWS b/NEWS index 4b9b4a2..1f8f401 100644 --- a/NEWS +++ b/NEWS @@ -1,3 +1,9 @@ +Changes in version 1.8.0 + +NEW FEATURES + + o Added a “private_clonotypes” function. + Changes in version 1.4.0 BUG FIXES
Roxygen documentation.
diff --git a/R/private_clonotypes.R b/R/private_clonotypes.R
index 48e28d8..e8eec4e 100644
--- a/R/private_clonotypes.R
+++ b/R/private_clonotypes.R
@@ -1,3 +1,19 @@
+#' private_clonotypes
+#'
+#' List clonotypes found exclusively in one library.
+#'
+#' @param ... Library names.
+#' @param data A clonotype table.
+#'
+#' @return A vector of clonotype names.
+#'
+#' @seealso \code{\link{clonotype_table}}
+#'
+#' @examples
+#' clonotypes <- read_clonotypes(system.file('extdata', 'clonotypes.txt.gz', package = "clonotypeR"))
+#' clonotypes <- clonotype_table(levels(clonotypes$lib), data=clonotypes)
+#' private_clonotypes("C", data=clonotypes)
+
private_clonotypes <- function (..., data) {
libs <- c(...)
@@ -8,7 +24,7 @@ if ( ! is.character(libs) ) stop (
)
if ( ! is.data.frame(data) ) stop (
- "Second argument must be a data frame of clonotypes."
+ "Data argument must be a data frame of clonotypes."
)
if ( FALSE %in% ( libs %in% colnames(data) ) ) stop (
diff --git a/man/private_clonotypes.Rd b/man/private_clonotypes.Rd
new file mode 100644
index 0000000..9fdd23b
--- /dev/null
+++ b/man/private_clonotypes.Rd
@@ -0,0 +1,28 @@
+% Generated by roxygen2 (4.1.1): do not edit by hand
+% Please edit documentation in R/private_clonotypes.R
+\name{private_clonotypes}
+\alias{private_clonotypes}
+\title{private_clonotypes}
+\usage{
+private_clonotypes(..., data)
+}
+\arguments{
+\item{...}{Library names.}
+
+\item{data}{A clonotype table.}
+}
+\value{
+A vector of clonotype names.
+}
+\description{
+List clonotypes found exclusively in one library.
+}
+\examples{
+clonotypes <- read_clonotypes(system.file('extdata', 'clonotypes.txt.gz', package = "clonotypeR"))
+clonotypes <- clonotype_table(levels(clonotypes$lib), data=clonotypes)
+private_clonotypes("C", data=clonotypes)
+}
+\seealso{
+\code{\link{clonotype_table}}
+}
+
Rstudio...
diff --git a/.Rbuildignore b/.Rbuildignore index 36312b8..13929dd 100644 --- a/.Rbuildignore +++ b/.Rbuildignore @@ -9,3 +9,5 @@ Makefile ^references$ ^scripts$ +^.*\.Rproj$ +^\.Rproj\.user$ diff --git a/.gitignore b/.gitignore index edd4856..fcd14f2 100644 --- a/.gitignore +++ b/.gitignore @@ -1 +1,2 @@ .ikiwiki +.Rproj.user
Show where to report bugs.
diff --git a/DESCRIPTION b/DESCRIPTION index dbe503a..4e3e018 100644 --- a/DESCRIPTION +++ b/DESCRIPTION @@ -20,3 +20,4 @@ Suggests: BiocGenerics, edgeR, knitr, pvclust, RUnit, vegan VignetteBuilder: knitr Packaged: 2013-12-11 10:22:39 UTC; charles biocViews: Sequencing +BugReports: http://clonotyper.branchable.com/Bugs/
Use the shorter URL, with https.
diff --git a/index.mdwn b/index.mdwn index e70b676..92fe6a2 100644 --- a/index.mdwn +++ b/index.mdwn @@ -8,7 +8,7 @@ in the order of millions, typically produced by Roche 454 instruments, and to prepare these sequences for differential expression analysis with the typical transcriptomics tools as well as for statistical analysis using existing [R][] packages. -[Bioconductor]: http://www.bioconductor.org/packages/release/bioc/html/clonotypeR.html +[Bioconductor]: https://www.bioconductor.org/packages/clonotypeR [R]: http://www.r-project.org/ "The R Project for Statistical Computing" *clonotypeR* is developed in the [RIKEN Yokohama Campus][RIKEN-Yokohama] by the
Ling to the omictools website.
diff --git a/index.mdwn b/index.mdwn index 5abd66f..e70b676 100644 --- a/index.mdwn +++ b/index.mdwn @@ -39,6 +39,7 @@ to try alternative solutions, you can have a look at [Decombinator](http://pubmed.gov/23303508 "Bioinformatics. 2013 Mar 1;29(5):542-50"), [MiTCR](http://mitcr.milaboratory.com/), or [MIGEC](http://migec.readthedocs.org/en/latest/cdrblast.html). +See also the [OMICtool](http://omictools.com/rep-seq-c424-p1.html) website for a longer list of repertoire tools. *clonotypeR* is placed in the [public domain](http://creativecommons.org/publicdomain/zero/1.0/).
Link to MIGEC.
diff --git a/index.mdwn b/index.mdwn index 7099cc2..5abd66f 100644 --- a/index.mdwn +++ b/index.mdwn @@ -36,8 +36,9 @@ Plessy|http://genome.gsc.riken.jp/osc/english/members/Charles_Plessy.html]] at RIKEN about shortcomings, limitations, or possible developments. If you need to try alternative solutions, you can have a look at [[IMGTHighV-QUEST|http://www.imgt.org/IMGTindex/IMGTHighV-QUEST.html]], -[Decombinator](http://pubmed.gov/23303508 "Bioinformatics. 2013 Mar 1;29(5):542-50"), or -[MiTCR](http://mitcr.milaboratory.com/). +[Decombinator](http://pubmed.gov/23303508 "Bioinformatics. 2013 Mar 1;29(5):542-50"), +[MiTCR](http://mitcr.milaboratory.com/), or +[MIGEC](http://migec.readthedocs.org/en/latest/cdrblast.html). *clonotypeR* is placed in the [public domain](http://creativecommons.org/publicdomain/zero/1.0/).
Commit made by the Bioconductor Git-SVN bridge.
Consists of 0 commit.
Commit information:
Consists of 0 commit.
Commit information:
diff --git a/DESCRIPTION b/DESCRIPTION index f304114..dbe503a 100644 --- a/DESCRIPTION +++ b/DESCRIPTION @@ -1,7 +1,7 @@ Package: clonotypeR Type: Package Title: High throughput analysis of T cell antigen receptor sequences -Version: 1.5.0 +Version: 1.7.0 Date: 2014-09-25 Author: Charles Plessy <plessy@riken.jp> Maintainer: Charles Plessy <plessy@riken.jp>
Bump versions in trunk after creation of 3.1 branch.
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@102594 bc3139a8-67e5-0310-9ffc-ced21a209358
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@102594 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/DESCRIPTION b/DESCRIPTION index 2f1eddb..dbe503a 100644 --- a/DESCRIPTION +++ b/DESCRIPTION @@ -1,7 +1,7 @@ Package: clonotypeR Type: Package Title: High throughput analysis of T cell antigen receptor sequences -Version: 1.6.0 +Version: 1.7.0 Date: 2014-09-25 Author: Charles Plessy <plessy@riken.jp> Maintainer: Charles Plessy <plessy@riken.jp>
Bump versions prior to creating 3.1 branch.
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@102591 bc3139a8-67e5-0310-9ffc-ced21a209358
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@102591 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/DESCRIPTION b/DESCRIPTION index f304114..2f1eddb 100644 --- a/DESCRIPTION +++ b/DESCRIPTION @@ -1,7 +1,7 @@ Package: clonotypeR Type: Package Title: High throughput analysis of T cell antigen receptor sequences -Version: 1.5.0 +Version: 1.6.0 Date: 2014-09-25 Author: Charles Plessy <plessy@riken.jp> Maintainer: Charles Plessy <plessy@riken.jp>
Hmmmm…
diff --git a/Bugs/Yassai_ID_should_have_no_codon_ID_in_absence_of_non-templated_codons..mdwn b/Bugs/Yassai_ID_should_have_no_codon_ID_in_absence_of_non-templated_codons..mdwn new file mode 100644 index 0000000..b0afa07 --- /dev/null +++ b/Bugs/Yassai_ID_should_have_no_codon_ID_in_absence_of_non-templated_codons..mdwn @@ -0,0 +1,6 @@ +<pre> +> yassai_identifier(c(V="TRAV14N-1", J="TRAJ56", dna="GCAGCTACTGGAGGCAATAATAAGCTGACT", pep="AATGGNNKLT")) +[1] "aa.1A14N1A56L10" +</pre> + +Should be `aa.A14N1A56L10`.
To do: clonotype algebra ?
diff --git a/TODO.mdwn b/TODO.mdwn index 525db48..82495ae 100644 --- a/TODO.mdwn +++ b/TODO.mdwn @@ -44,3 +44,11 @@ compare the number of lines to what is expected. Support extraction of barcoded reads. Report the number of V segments found after `clonotypeR detect`. + +Clonotype algebra, like in: + +<pre> +`+.clonotypeList` <- function(X, Y) structure( union(X, Y), class='clonotypeList') +`^.clonotypeList` <- function(X, Y) structure( intersect(X, Y), class='clonotypeList') +`-.clonotypeList` <- function(X, Y) structure( setdiff(X, Y), class='clonotypeList') +</pre>
Commit made by the Bioconductor Git-SVN bridge.
Consists of 2 commits.
Commit information:
Commit id: 68cdc95e69dd63e8c1d1698036dd7616a982af38
private_clonotpes: a function to list clonotypes found exclusively in one lib.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2015-02-05 18:56:07 +0900
Author date: 2015-02-05 18:56:07 +0900
Commit id: 8d7215daaefb49b05c9b9d2873877c9d7529c275
Does not use a default table anymore.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2015-02-05 18:09:02 +0900
Author date: 2015-02-05 18:09:02 +0900
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@99073 bc3139a8-67e5-0310-9ffc-ced21a209358
Consists of 2 commits.
Commit information:
Commit id: 68cdc95e69dd63e8c1d1698036dd7616a982af38
private_clonotpes: a function to list clonotypes found exclusively in one lib.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2015-02-05 18:56:07 +0900
Author date: 2015-02-05 18:56:07 +0900
Commit id: 8d7215daaefb49b05c9b9d2873877c9d7529c275
Does not use a default table anymore.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2015-02-05 18:09:02 +0900
Author date: 2015-02-05 18:09:02 +0900
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@99073 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/R/private_clonotypes.R b/R/private_clonotypes.R
new file mode 100644
index 0000000..48e28d8
--- /dev/null
+++ b/R/private_clonotypes.R
@@ -0,0 +1,28 @@
+private_clonotypes <- function (..., data) {
+
+libs <- c(...)
+otherLibs <- setdiff(colnames(data), libs)
+
+if ( ! is.character(libs) ) stop (
+ "First argument must be a character vector of library names."
+)
+
+if ( ! is.data.frame(data) ) stop (
+ "Second argument must be a data frame of clonotypes."
+)
+
+if ( FALSE %in% ( libs %in% colnames(data) ) ) stop (
+ paste("Unknown library: ", libs[ ! libs %in% colnames(data) ],".", sep='', collapse=' ')
+)
+
+clonotypenames <- rownames(data)
+
+# drop=FALSE otherwise rowSums fails when there is only one column.
+
+expressedInLibs <- rowSums(data[, libs , drop=FALSE]) > 0
+absentInOtherLibs <- rowSums(data[, otherLibs, drop=FALSE]) == 0
+
+return(
+ clonotypenames[ expressedInLibs & absentInOtherLibs ]
+)
+}
diff --git a/man/unique_clonotypes.Rd b/man/unique_clonotypes.Rd
index 7e5fff9..2a4d865 100644
--- a/man/unique_clonotypes.Rd
+++ b/man/unique_clonotypes.Rd
@@ -16,10 +16,6 @@ clonotype_table.
\item{data}{The name of the clonotype_table where the data is stored.}
}
-\details{
-Uses the table called \dQuote{clonotypes} by default.
-}
-
\value{
Character vector of clonotype names. Their order follows the original row name
order of the clonotype_table.
private_clonotpes: a function to list clonotypes found exclusively in one lib.
diff --git a/R/private_clonotypes.R b/R/private_clonotypes.R
new file mode 100644
index 0000000..48e28d8
--- /dev/null
+++ b/R/private_clonotypes.R
@@ -0,0 +1,28 @@
+private_clonotypes <- function (..., data) {
+
+libs <- c(...)
+otherLibs <- setdiff(colnames(data), libs)
+
+if ( ! is.character(libs) ) stop (
+ "First argument must be a character vector of library names."
+)
+
+if ( ! is.data.frame(data) ) stop (
+ "Second argument must be a data frame of clonotypes."
+)
+
+if ( FALSE %in% ( libs %in% colnames(data) ) ) stop (
+ paste("Unknown library: ", libs[ ! libs %in% colnames(data) ],".", sep='', collapse=' ')
+)
+
+clonotypenames <- rownames(data)
+
+# drop=FALSE otherwise rowSums fails when there is only one column.
+
+expressedInLibs <- rowSums(data[, libs , drop=FALSE]) > 0
+absentInOtherLibs <- rowSums(data[, otherLibs, drop=FALSE]) == 0
+
+return(
+ clonotypenames[ expressedInLibs & absentInOtherLibs ]
+)
+}
Does not use a default table anymore.
diff --git a/man/unique_clonotypes.Rd b/man/unique_clonotypes.Rd
index 7e5fff9..2a4d865 100644
--- a/man/unique_clonotypes.Rd
+++ b/man/unique_clonotypes.Rd
@@ -16,10 +16,6 @@ clonotype_table.
\item{data}{The name of the clonotype_table where the data is stored.}
}
-\details{
-Uses the table called \dQuote{clonotypes} by default.
-}
-
\value{
Character vector of clonotype names. Their order follows the original row name
order of the clonotype_table.
Removed cruft.
diff --git a/doc/seaview.mdwn b/doc/seaview.mdwn index 3a2b487..bbdd8a2 100644 --- a/doc/seaview.mdwn +++ b/doc/seaview.mdwn @@ -2,8 +2,6 @@ _Page in construction…_ -<span style="background: red; font-family: monospace">TTT</span> - [SeaView](http://doua.prabi.fr/software/seaview) is a “multiplatform, graphical user interface for multiple sequence alignment and molecular phylogeny”. In addition to the traditional display of nucleotides, it can color the alignment
More explanations on how to visualise the alignments with SeaView.
diff --git a/doc/seaview.mdwn b/doc/seaview.mdwn index 5c99ac4..3a2b487 100644 --- a/doc/seaview.mdwn +++ b/doc/seaview.mdwn @@ -12,13 +12,19 @@ very useful for manual alignemnt of _V_ and _J_ segments. ### Nucleotide view +J segments must be aligned on the `FGxG` motif, but in the default view it is +not very obvious to see. Switch to the codon view or the aminoacid view. + [[!img SeaView_nucleotides.png alt="SeaView displaying colored nucleotides."]] ### Codon view +Here, the `FGxG` motif stands out like for example “<span style="background: red; font-family: monospace">TTC</span><span style="background: lime; font-family: monospace">GGT</span><span style="background: olive; font-family: monospace">CAT</span><span style="background: lime; font-family: monospace">GGA</span>”. This mode is very useful for finding the relevant reading frame, by adding or removing gaps before the first nucleotide. + [[!img SeaView_codons.png alt="SeaView displaying colored codons."]] ### Aminoacid view -[[!img SeaView_aminoacids.png alt="SeaView displaying colored aminoacids translated from the DNA sequences."]] +This mode is very useful for aligning in-frame sequences, checking the final alignment, and spotting easily the stop codons in pseudogenised segments. +[[!img SeaView_aminoacids.png alt="SeaView displaying colored aminoacids translated from the DNA sequences."]]
diff --git a/doc/seaview.mdwn b/doc/seaview.mdwn index b40f1c6..5c99ac4 100644 --- a/doc/seaview.mdwn +++ b/doc/seaview.mdwn @@ -2,6 +2,8 @@ _Page in construction…_ +<span style="background: red; font-family: monospace">TTT</span> + [SeaView](http://doua.prabi.fr/software/seaview) is a “multiplatform, graphical user interface for multiple sequence alignment and molecular phylogeny”. In addition to the traditional display of nucleotides, it can color the alignment
Syntax correction.
diff --git a/doc/seaview.mdwn b/doc/seaview.mdwn index c0fb06e..b40f1c6 100644 --- a/doc/seaview.mdwn +++ b/doc/seaview.mdwn @@ -14,7 +14,7 @@ very useful for manual alignemnt of _V_ and _J_ segments. ### Codon view -[[!img SeaView_codons.png alt="SeaView displaying colored codons."] +[[!img SeaView_codons.png alt="SeaView displaying colored codons."]] ### Aminoacid view
Link to the SeaView page.
diff --git a/references/README.mdwn b/references/README.mdwn index 4f98128..8f7211a 100644 --- a/references/README.mdwn +++ b/references/README.mdwn @@ -10,7 +10,7 @@ extracted with the command `make gb2fa`, wich uses the the [extractfeat][] program of the EMBOSS package. This directory contains *V* and *J* segments aligned on conserved motifs in the -files [[V.fa]] and [[J.fa]]. These alignments were made by hand using [SeaView][] and +files [[V.fa]] and [[J.fa]]. These alignments were made by hand using [[SeaView|doc/seaview]] and may need to be revised when the reference sequences change. [Mmus_TRA]: http://www.ncbi.nlm.nih.gov/nuccore/NG_007044 (Mus musculus T cell receptor alpha delta locus (Tcra/tcrd@) on chromosome 14)
Documenting the different alignment modes of SeaView.
diff --git a/doc/seaview.mdwn b/doc/seaview.mdwn new file mode 100644 index 0000000..c0fb06e --- /dev/null +++ b/doc/seaview.mdwn @@ -0,0 +1,22 @@ +# Alignment of V and J segements with SeaView. + +_Page in construction…_ + +[SeaView](http://doua.prabi.fr/software/seaview) is a “multiplatform, graphical +user interface for multiple sequence alignment and molecular phylogeny”. In +addition to the traditional display of nucleotides, it can color the alignment +by codons, or display the DNA sequence translated as protein. This makes it +very useful for manual alignemnt of _V_ and _J_ segments. + +### Nucleotide view + +[[!img SeaView_nucleotides.png alt="SeaView displaying colored nucleotides."]] + +### Codon view + +[[!img SeaView_codons.png alt="SeaView displaying colored codons."] + +### Aminoacid view + +[[!img SeaView_aminoacids.png alt="SeaView displaying colored aminoacids translated from the DNA sequences."]] + diff --git a/doc/seaview/SeaView_aminoacids.png b/doc/seaview/SeaView_aminoacids.png new file mode 100644 index 0000000..929bf6f Binary files /dev/null and b/doc/seaview/SeaView_aminoacids.png differ diff --git a/doc/seaview/SeaView_codons.png b/doc/seaview/SeaView_codons.png new file mode 100644 index 0000000..3d7ebd4 Binary files /dev/null and b/doc/seaview/SeaView_codons.png differ diff --git a/doc/seaview/SeaView_nucleotides.png b/doc/seaview/SeaView_nucleotides.png new file mode 100644 index 0000000..3d2bd23 Binary files /dev/null and b/doc/seaview/SeaView_nucleotides.png differ
Link to new Bioconductor release.
diff --git a/index.mdwn b/index.mdwn
index f5ecc8b..7099cc2 100644
--- a/index.mdwn
+++ b/index.mdwn
@@ -45,6 +45,8 @@ to try alternative solutions, you can have a look at
### Recent news
+ * October 2014: New stable version [1.4](http://www.bioconductor.org/packages/3.0/bioc/html/clonotypeR.html)
+ released on Bioconductor.
* 25 September 2014: version 1.3.2 compatible with EMBOSS 6.6.0.
* March 2014: New stable version [1.2](http://www.bioconductor.org/packages/2.14/bioc/html/clonotypeR.html)
released on Bioconductor.
Commit made by the Bioconductor Git-SVN bridge.
Consists of 1 commit.
Commit information:
SVN Revision number: 95443
Commit message:
Bumping versions after creating 3.0 release branch.
Committed by d.tenenbaum
Committed at: 2014-10-13T21:47:41.382147Z
Consists of 1 commit.
Commit information:
SVN Revision number: 95443
Commit message:
Bumping versions after creating 3.0 release branch.
Committed by d.tenenbaum
Committed at: 2014-10-13T21:47:41.382147Z
diff --git a/DESCRIPTION b/DESCRIPTION index ea7a4e3..f304114 100644 --- a/DESCRIPTION +++ b/DESCRIPTION @@ -1,7 +1,7 @@ Package: clonotypeR Type: Package Title: High throughput analysis of T cell antigen receptor sequences -Version: 1.4.0 +Version: 1.5.0 Date: 2014-09-25 Author: Charles Plessy <plessy@riken.jp> Maintainer: Charles Plessy <plessy@riken.jp>
Bumping versions after creating 3.0 release branch.
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@95443 bc3139a8-67e5-0310-9ffc-ced21a209358
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@95443 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/DESCRIPTION b/DESCRIPTION index ea7a4e3..f304114 100644 --- a/DESCRIPTION +++ b/DESCRIPTION @@ -1,7 +1,7 @@ Package: clonotypeR Type: Package Title: High throughput analysis of T cell antigen receptor sequences -Version: 1.4.0 +Version: 1.5.0 Date: 2014-09-25 Author: Charles Plessy <plessy@riken.jp> Maintainer: Charles Plessy <plessy@riken.jp>
Commit made by the Bioconductor Git-SVN bridge.
Consists of 1 commit.
Commit information:
SVN Revision number: 95439
Commit message:
Bump package versions prior to creating the 3.0 branch.
Committed by d.tenenbaum
Committed at: 2014-10-13T21:38:33.867451Z
Consists of 1 commit.
Commit information:
SVN Revision number: 95439
Commit message:
Bump package versions prior to creating the 3.0 branch.
Committed by d.tenenbaum
Committed at: 2014-10-13T21:38:33.867451Z
diff --git a/DESCRIPTION b/DESCRIPTION index 1ef9e8b..ea7a4e3 100644 --- a/DESCRIPTION +++ b/DESCRIPTION @@ -1,7 +1,7 @@ Package: clonotypeR Type: Package Title: High throughput analysis of T cell antigen receptor sequences -Version: 1.3.2 +Version: 1.4.0 Date: 2014-09-25 Author: Charles Plessy <plessy@riken.jp> Maintainer: Charles Plessy <plessy@riken.jp>
Bump package versions prior to creating the 3.0 branch.
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@95439 bc3139a8-67e5-0310-9ffc-ced21a209358
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@95439 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/DESCRIPTION b/DESCRIPTION index 1ef9e8b..ea7a4e3 100644 --- a/DESCRIPTION +++ b/DESCRIPTION @@ -1,7 +1,7 @@ Package: clonotypeR Type: Package Title: High throughput analysis of T cell antigen receptor sequences -Version: 1.3.2 +Version: 1.4.0 Date: 2014-09-25 Author: Charles Plessy <plessy@riken.jp> Maintainer: Charles Plessy <plessy@riken.jp>
Release version 1.3.2.
diff --git a/index.mdwn b/index.mdwn
index 357e7b9..f5ecc8b 100644
--- a/index.mdwn
+++ b/index.mdwn
@@ -45,6 +45,7 @@ to try alternative solutions, you can have a look at
### Recent news
+ * 25 September 2014: version 1.3.2 compatible with EMBOSS 6.6.0.
* March 2014: New stable version [1.2](http://www.bioconductor.org/packages/2.14/bioc/html/clonotypeR.html)
released on Bioconductor.
* 11 December 2013: Version 1.1.3 adding a `long` option to `yassai_identifier`, solving
Commit made by the Bioconductor Git-SVN bridge.
Consists of 4 commits.
Commit information:
Commit id: 8a1934044597a69bacf2acd3594c3183661d6e7f
Version 1.3.2, release candidate.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-09-25 18:20:39 +0900
Author date: 2014-09-25 18:20:39 +0900
Commit id: 46cc1439ff43464b15a90efe222afe59a419cd2c
Upcoming version 1.4.0: no major changes.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-09-25 18:17:00 +0900
Author date: 2014-09-25 18:17:00 +0900
Commit id: ae5e044a195fdc86dd0af7bdfddf27fb37dab0f4
Uppercase final letter in 'clonotypeR'.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-09-25 13:33:29 +0900
Author date: 2014-09-25 13:33:29 +0900
Commit id: 0f724d3a35d432366a5b41fc7514af1d89da506a
Corrected a typo.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-09-25 13:31:40 +0900
Author date: 2014-09-25 13:31:40 +0900
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@94519 bc3139a8-67e5-0310-9ffc-ced21a209358
Consists of 4 commits.
Commit information:
Commit id: 8a1934044597a69bacf2acd3594c3183661d6e7f
Version 1.3.2, release candidate.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-09-25 18:20:39 +0900
Author date: 2014-09-25 18:20:39 +0900
Commit id: 46cc1439ff43464b15a90efe222afe59a419cd2c
Upcoming version 1.4.0: no major changes.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-09-25 18:17:00 +0900
Author date: 2014-09-25 18:17:00 +0900
Commit id: ae5e044a195fdc86dd0af7bdfddf27fb37dab0f4
Uppercase final letter in 'clonotypeR'.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-09-25 13:33:29 +0900
Author date: 2014-09-25 13:33:29 +0900
Commit id: 0f724d3a35d432366a5b41fc7514af1d89da506a
Corrected a typo.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-09-25 13:31:40 +0900
Author date: 2014-09-25 13:31:40 +0900
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@94519 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/ChangeLog b/ChangeLog
index 8c90a52..06e2de0 100644
--- a/ChangeLog
+++ b/ChangeLog
@@ -1,3 +1,8 @@
+2014-09-25 Charles Plessy <plessy@riken.jp>
+ * Version 1.3.2
+ * Import “methods” instead of depending on.
+ * Corrected typos.
+
2014-04-08 Charles Plessy <plessy@riken.jp>
* Version 1.1.6
* Transfer “NEWS” to ChangeLog and add release notes to “NEWS”.
@@ -8,7 +13,7 @@
2014-03-05 Bioc admins
* Version 1.1.4.
- * Change biocviews to “Sequencing”,
+ * Change biocviews to “Sequencing”.
2013-12-11 Charles Plessy <plessy@riken>
* Committed 1.1.3 to Bioconductor.
diff --git a/DESCRIPTION b/DESCRIPTION
index 3370138..1ef9e8b 100644
--- a/DESCRIPTION
+++ b/DESCRIPTION
@@ -1,7 +1,7 @@
Package: clonotypeR
Type: Package
Title: High throughput analysis of T cell antigen receptor sequences
-Version: 1.3.1
+Version: 1.3.2
Date: 2014-09-25
Author: Charles Plessy <plessy@riken.jp>
Maintainer: Charles Plessy <plessy@riken.jp>
diff --git a/NEWS b/NEWS
index e8067a7..4b9b4a2 100644
--- a/NEWS
+++ b/NEWS
@@ -1,3 +1,9 @@
+Changes in version 1.4.0
+
+BUG FIXES
+
+ o Minor packaging corrections (NAMESPACE, etc.).
+
Changes in version 1.2.0
NEW FEATURES
diff --git a/vignettes/clonotypeR.Rmd b/vignettes/clonotypeR.Rmd
index 32f4fe7..8679d56 100644
--- a/vignettes/clonotypeR.Rmd
+++ b/vignettes/clonotypeR.Rmd
@@ -126,13 +126,13 @@ of the display).
### Detection of V segments
-Run the command `clonotyper detect A.fastq` in the same directory as a copy of
+Run the command `clonotypeR detect A.fastq` in the same directory as a copy of
the file `A.fastq`.
The result is stored in a temporary directory called `extraction_files`, that
will be created if it does not already exist.
-`clonotyper detect` compares the sequences to the reference V segments using
+`clonotypeR detect` compares the sequences to the reference V segments using
BWA, and produces output like the following.
[bsw2_aln] read 2000 sequences/pairs (843395 bp)...
@@ -146,13 +146,13 @@ pairs in total. There were 167 reference V segments, and the version number of
BWA was `0.6.2-r126`. The whole process took less than 10 seconds.
Process the example libraries `B` and `C` similarly with the commands
-`clonotyper detect C.fastq` and `clonotyper detect C.fastq`.
+`clonotypeR detect B.fastq` and `clonotypeR detect C.fastq`.
### Extraction of CDR3 regions
-Run the command `clonotyper extract A` in the same directory as where you ran
-`clonotyper detect A.fastq`. The result is a table stored in a directory
+Run the command `clonotypeR extract A` in the same directory as where you ran
+`clonotypeR detect A.fastq`. The result is a table stored in a directory
called `clonotypes`, that will be created if it does not already exist.
The output is quite voluminous, and indicates which *V* / *J* combinations are
Version 1.3.2, release candidate.
diff --git a/ChangeLog b/ChangeLog index 8c90a52..06e2de0 100644 --- a/ChangeLog +++ b/ChangeLog @@ -1,3 +1,8 @@ +2014-09-25 Charles Plessy <plessy@riken.jp> + * Version 1.3.2 + * Import “methods” instead of depending on. + * Corrected typos. + 2014-04-08 Charles Plessy <plessy@riken.jp> * Version 1.1.6 * Transfer “NEWS” to ChangeLog and add release notes to “NEWS”. @@ -8,7 +13,7 @@ 2014-03-05 Bioc admins * Version 1.1.4. - * Change biocviews to “Sequencing”, + * Change biocviews to “Sequencing”. 2013-12-11 Charles Plessy <plessy@riken> * Committed 1.1.3 to Bioconductor. diff --git a/DESCRIPTION b/DESCRIPTION index 3370138..1ef9e8b 100644 --- a/DESCRIPTION +++ b/DESCRIPTION @@ -1,7 +1,7 @@ Package: clonotypeR Type: Package Title: High throughput analysis of T cell antigen receptor sequences -Version: 1.3.1 +Version: 1.3.2 Date: 2014-09-25 Author: Charles Plessy <plessy@riken.jp> Maintainer: Charles Plessy <plessy@riken.jp>
Upcoming version 1.4.0: no major changes.
diff --git a/NEWS b/NEWS index e8067a7..4b9b4a2 100644 --- a/NEWS +++ b/NEWS @@ -1,3 +1,9 @@ +Changes in version 1.4.0 + +BUG FIXES + + o Minor packaging corrections (NAMESPACE, etc.). + Changes in version 1.2.0 NEW FEATURES
Correct version number of EMBOSS.
diff --git a/Bugs/Does_not_work_with_EMBOSS_6.6.0..mdwn b/Bugs/Does_not_work_with_EMBOSS_6.6.0..mdwn index bbbe652..fdea6b3 100644 --- a/Bugs/Does_not_work_with_EMBOSS_6.6.0..mdwn +++ b/Bugs/Does_not_work_with_EMBOSS_6.6.0..mdwn @@ -1,4 +1,4 @@ -In EMBOSS 6.6.6, sequence addresses with a dash and a colon cause are parsed as 'dbname:entry' instead of 'file:entry' when an appropriate directory name exists. +In EMBOSS 6.6.0, sequence addresses with a dash and a colon cause are parsed as 'dbname:entry' instead of 'file:entry' when an appropriate directory name exists. <pre> echo -e '>A\nAAAAAA' > test-1.fa
Suppress warnings in vectorscript.
Since EMBOSS 6.6.0, vectorscript emits a warning when no matches are
found, which is annoying here. Better solutions are welcome.
Since EMBOSS 6.6.0, vectorscript emits a warning when no matches are
found, which is annoying here. Better solutions are welcome.
diff --git a/scripts/VJsplit b/scripts/VJsplit
index 4b23919..b7502ea 100755
--- a/scripts/VJsplit
+++ b/scripts/VJsplit
@@ -72,7 +72,7 @@ do
fi
echo -ne "\t$J_NAME\t" 1>&2
J_SEQ=$(seqret -filter $CLONOTYPER_REFERENCE/${J_LIB}-FGxG.fa:$J_NAME[:20] raw:stdout)
- vectorstrip -auto \
+ EMBOSS_WARNING=FALSE vectorstrip -auto \
-readfile N \
-mismatch $VS_MISMATCH \
-blinker $(seqret -filter $CLONOTYPER_REFERENCE/${J_LIB}-FGxG.fa:$J_NAME[:20] raw:stdout) \
Merge branch 'bioc'
Shortcut to commit.
diff --git a/Bugs/Incorrect_identifiers_when_V-J_boundary_is_a_codon_boundary_.mdwn b/Bugs/Incorrect_identifiers_when_V-J_boundary_is_a_codon_boundary_.mdwn index 1648dce..7b7fef9 100644 --- a/Bugs/Incorrect_identifiers_when_V-J_boundary_is_a_codon_boundary_.mdwn +++ b/Bugs/Incorrect_identifiers_when_V-J_boundary_is_a_codon_boundary_.mdwn @@ -3,7 +3,7 @@ [1] "tg.integer(0)A2A61L13" </pre> -[[Done]] in `2b8514d18f312f627255b0f2eb0ec1bf4ffa48dd`, by return an empty chain instead of `integer(0)` when receiving an empty chain. +[[Done]] in [[!commit 2b8514d18f312f627255b0f2eb0ec1bf4ffa48dd]], by return an empty chain instead of `integer(0)` when receiving an empty chain. Result after correction:
Shortcut to commit.
diff --git a/Bugs/Clonotype_that_takes_ages_for_calculating_the_Yassai_identifier..mdwn b/Bugs/Clonotype_that_takes_ages_for_calculating_the_Yassai_identifier..mdwn index 7cdfc91..e813803 100644 --- a/Bugs/Clonotype_that_takes_ages_for_calculating_the_Yassai_identifier..mdwn +++ b/Bugs/Clonotype_that_takes_ages_for_calculating_the_Yassai_identifier..mdwn @@ -45,7 +45,7 @@ TRAV14N-3 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ This triggered an infinite loop when calling `is.germline()`. -[[Done]] in `42ab98729c5c77462b5929b00ee973074ae4c1c7`. +[[Done]] in [[!commit 42ab98729c5c77462b5929b00ee973074ae4c1c7]]. Now the function should return as in the following example.
Edit rebased commit ID.
diff --git a/Bugs/Does_not_work_with_EMBOSS_6.6.0..mdwn b/Bugs/Does_not_work_with_EMBOSS_6.6.0..mdwn index 45abb7d..bbbe652 100644 --- a/Bugs/Does_not_work_with_EMBOSS_6.6.0..mdwn +++ b/Bugs/Does_not_work_with_EMBOSS_6.6.0..mdwn @@ -19,4 +19,4 @@ seqret test-1.fa:A stdout See also <http://lists.open-bio.org/pipermail/emboss/2014-June/008983.html> -[[Done]] with the following workaround: the directory `references/V` was renamed `references/V-C` in [[!commit 055b6807d3f0e6fc6dda58f5699c6ac34fbc89c2]]. +[[Done]] with the following workaround: the directory `references/V` was renamed `references/V-C` in [[!commit 125524131bd57c084ee39374054b73784e6ae929]].
Add a new shortcut for commits.
diff --git a/shortcuts.mdwn b/shortcuts.mdwn index ca529c2..0cd4821 100644 --- a/shortcuts.mdwn +++ b/shortcuts.mdwn @@ -64,6 +64,8 @@ This page controls what shortcut links the wiki supports. * [[!shortcut name=freebsdwiki url="http://wiki.freebsd.org/%s"]] * [[!shortcut name=hackage url="http://hackage.haskell.org/package/%s"]] +* [[!shortcut name=commit url="http://source.clonotyper.branchable.com/?p=source.git;a=commitdiff;h=%s"]] + To add a new shortcut, use the `shortcut` [[ikiwiki/directive]]. In the url, "%s" is replaced with the text passed to the named shortcut, after [[!wikipedia url_encoding]]
Ikiwiki's shortcuts page.
diff --git a/shortcuts.mdwn b/shortcuts.mdwn new file mode 100644 index 0000000..ca529c2 --- /dev/null +++ b/shortcuts.mdwn @@ -0,0 +1,83 @@ +[[!if test="enabled(shortcut)" + then="This wiki has shortcuts **enabled**." + else="This wiki has shortcuts **disabled**."]] + +Some examples of using shortcuts include: + + \[[!google foo]] + \[[!wikipedia War_of_1812]] + \[[!debbug 12345]] + Check the \[[!google ikiwiki desc="google search for %s"]]. + +This page controls what shortcut links the wiki supports. + +* [[!shortcut name=google url="https://encrypted.google.com/search?q=%s"]] +* [[!shortcut name=archive url="http://web.archive.org/*/%S"]] +* [[!shortcut name=gmap url="https://maps.google.com/maps?q=%s"]] +* [[!shortcut name=gmsg url="https://groups.google.com/groups?selm=%s"]] +* [[!shortcut name=wikipedia url="https://en.wikipedia.org/wiki/%W"]] +* [[!shortcut name=wikitravel url="https://wikitravel.org/en/%s"]] +* [[!shortcut name=wiktionary url="https://en.wiktionary.org/wiki/%s"]] +* [[!shortcut name=debbug url="http://bugs.debian.org/%S" desc="Debian bug #%s"]] +* [[!shortcut name=deblist url="https://lists.debian.org/debian-%s" desc="debian-%s@lists.debian.org"]] +* [[!shortcut name=debpkg url="http://packages.debian.org/%s"]] +* [[!shortcut name=debpkgsid url="http://packages.debian.org/sid/%s"]] +* [[!shortcut name=debpts url="http://packages.qa.debian.org/%s"]] +* [[!shortcut name=debmsg url="https://lists.debian.org/msgid-search/%s"]] +* [[!shortcut name=debrt url="https://rt.debian.org/Ticket/Display.html?id=%s"]] +* [[!shortcut name=debss url="http://snapshot.debian.org/package/%s/"]] + * Usage: `\[[!debss package]]` or `\[[!debss package/version]]`. See <http://snapshot.debian.org/> for details. +* [[!shortcut name=debwiki url="https://wiki.debian.org/%S"]] +* [[!shortcut name=fdobug url="https://bugs.freedesktop.org/show_bug.cgi?id=%s" desc="freedesktop.org bug #%s"]] +* [[!shortcut name=fdolist url="http://lists.freedesktop.org/mailman/listinfo/%s" desc="%s@lists.freedesktop.org"]] +* [[!shortcut name=gnomebug url="https://bugzilla.gnome.org/show_bug.cgi?id=%s" desc="GNOME bug #%s"]] +* [[!shortcut name=linuxbug url="https://bugzilla.kernel.org/show_bug.cgi?id=%s" desc="Linux bug #%s"]] +* [[!shortcut name=mozbug url="https://bugzilla.mozilla.org/show_bug.cgi?id=%s" desc="Mozilla bug #%s"]] +* [[!shortcut name=gnulist url="https://lists.gnu.org/mailman/listinfo/%s" desc="%s@gnu.org"]] +* [[!shortcut name=marcmsg url="http://marc.info/?i=%s"]] +* [[!shortcut name=marclist url="http://marc.info/?l=%s"]] +* [[!shortcut name=gmane url="http://dir.gmane.org/gmane.%s" desc="gmane.%s"]] +* [[!shortcut name=gmanemsg url="http://mid.gmane.org/%s"]] +* [[!shortcut name=cpan url="http://search.cpan.org/search?mode=dist&query=%s"]] +* [[!shortcut name=ctan url="http://tug.ctan.org/cgi-bin/ctanPackageInformation.py?id=%s"]] +* [[!shortcut name=hoogle url="http://haskell.org/hoogle/?q=%s"]] +* [[!shortcut name=iki url="http://ikiwiki.info/%S/"]] +* [[!shortcut name=ljuser url="http://%s.livejournal.com/"]] +* [[!shortcut name=rfc url="https://www.ietf.org/rfc/rfc%s.txt" desc="RFC %s"]] +* [[!shortcut name=c2 url="http://c2.com/cgi/wiki?%s"]] +* [[!shortcut name=meatballwiki url="http://www.usemod.com/cgi-bin/mb.pl?%s"]] +* [[!shortcut name=emacswiki url="http://www.emacswiki.org/cgi-bin/wiki/%s"]] +* [[!shortcut name=haskellwiki url="http://haskell.org/haskellwiki/%s"]] +* [[!shortcut name=dict url="http://www.dict.org/bin/Dict?Form=Dict1&Strategy=*&Database=*&Query=%s"]] +* [[!shortcut name=imdb url="http://imdb.com/find?q=%s"]] +* [[!shortcut name=gpg url="http://pgpkeys.mit.edu:11371/pks/lookup?op=vindex&exact=on&search=0x%s"]] +* [[!shortcut name=perldoc url="http://perldoc.perl.org/search.html?q=%s"]] +* [[!shortcut name=whois url="http://reports.internic.net/cgi/whois?whois_nic=%s&type=domain"]] +* [[!shortcut name=cve url="https://cve.mitre.org/cgi-bin/cvename.cgi?name=%s"]] +* [[!shortcut name=flickr url="https://secure.flickr.com/photos/%s"]] +* [[!shortcut name=man url="http://manpages.debian.org/%s"]] +* [[!shortcut name=ohloh url="https://www.ohloh.net/p/%s"]] +* [[!shortcut name=cpanrt url="https://rt.cpan.org/Ticket/Display.html?id=%s" desc="CPAN RT#%s"]] +* [[!shortcut name=novellbug url="https://bugzilla.novell.com/show_bug.cgi?id=%s" desc="bug %s"]] +* [[!shortcut name=ubupkg url="http://packages.ubuntu.com/%s"]] +* [[!shortcut name=mozillazinekb url="http://kb.mozillazine.org/%s"]] +* [[!shortcut name=freebsdwiki url="http://wiki.freebsd.org/%s"]] +* [[!shortcut name=hackage url="http://hackage.haskell.org/package/%s"]] + +To add a new shortcut, use the `shortcut` +[[ikiwiki/directive]]. In the url, "%s" is replaced with the +text passed to the named shortcut, after [[!wikipedia url_encoding]] +it, and '%S' is replaced with the raw, non-encoded text. +Additionally, `%W` is replaced with the text encoded just right for +Wikipedia. The optional `desc` parameter controls the description of +the link. + +Remember that the `name` you give the shortcut will become a new +[[ikiwiki/directive]]. Avoid using a `name` that conflicts +with an existing directive. These directives also accept a `desc` +parameter that will override the one provided at definition time. + +If you come up with a shortcut that you think others might find useful, +consider contributing it to the [shortcuts page on the ikiwiki +wiki](http://ikiwiki.info/shortcuts/), so that future versions of +ikiwiki will include your shortcut in the standard underlay.
Workaround: rename V directory to V-C.
diff --git a/Bugs/Does_not_work_with_EMBOSS_6.6.0..mdwn b/Bugs/Does_not_work_with_EMBOSS_6.6.0..mdwn index c95cbe8..45abb7d 100644 --- a/Bugs/Does_not_work_with_EMBOSS_6.6.0..mdwn +++ b/Bugs/Does_not_work_with_EMBOSS_6.6.0..mdwn @@ -1,4 +1,4 @@ -The reason is the following bug in EMBOSS. +In EMBOSS 6.6.6, sequence addresses with a dash and a colon cause are parsed as 'dbname:entry' instead of 'file:entry' when an appropriate directory name exists. <pre> echo -e '>A\nAAAAAA' > test-1.fa @@ -16,3 +16,7 @@ seqret test-1.fa:A stdout # Error: Unable to read sequence 'test-1.fa:A' # Died: seqret terminated: Bad value for '-sequence' and no prompt </pre> + +See also <http://lists.open-bio.org/pipermail/emboss/2014-June/008983.html> + +[[Done]] with the following workaround: the directory `references/V` was renamed `references/V-C` in [[!commit 055b6807d3f0e6fc6dda58f5699c6ac34fbc89c2]].
Moved references/V to references/V-C. This solves an ambiguity in seqret.
Closes: http://clonotyper.branchable.com/Bugs/Does_not_work_with_EMBOSS_6.6.0./
Closes: http://clonotyper.branchable.com/Bugs/Does_not_work_with_EMBOSS_6.6.0./
diff --git a/doc/examples/with_test_data.mdwn b/doc/examples/with_test_data.mdwn
index 2808808..1dfa0dc 100644
--- a/doc/examples/with_test_data.mdwn
+++ b/doc/examples/with_test_data.mdwn
@@ -36,7 +36,7 @@ BWA, and produces output like the following.
[bsw2_aln] read 2000 sequences/pairs (843395 bp)...
[samopen] SAM header is present: 167 sequences.
[main] Version: 0.6.2-r126
- [main] CMD: bwa bwasw -t8 /usr/share/clonotypeR/references/V/index A.fastq
+ [main] CMD: bwa bwasw -t8 /usr/share/clonotypeR/references/V-C/index A.fastq
[main] Real time: 1.099 sec; CPU: 8.225 sec
This indicates that 2,000 reads have been processed, representing 843,395 base
diff --git a/html_doc/clonotypeR.html b/html_doc/clonotypeR.html
index aab33f8..3b262f0 100644
--- a/html_doc/clonotypeR.html
+++ b/html_doc/clonotypeR.html
@@ -392,7 +392,7 @@ BWA, and produces output like the following.</p>
<pre><code>[bsw2_aln] read 2000 sequences/pairs (843395 bp)...
[samopen] SAM header is present: 167 sequences.
[main] Version: 0.6.2-r126
-[main] CMD: bwa bwasw -t8 /usr/share/clonotypeR/references/V/index A.fastq
+[main] CMD: bwa bwasw -t8 /usr/share/clonotypeR/references/V-C/index A.fastq
[main] Real time: 1.099 sec; CPU: 8.225 sec
</code></pre>
diff --git a/references/Makefile b/references/Makefile
index de53e5f..e775f3c 100644
--- a/references/Makefile
+++ b/references/Makefile
@@ -4,9 +4,9 @@ gb2fa: TRA@.gb TRB@.gb TRG@.gb
../scripts/gb2fa.bash
bwa-index: V-C.fa
- ln -s ../V-C.fa V/index
- bwa index V/index
- rm V/index
+ ln -s ../V-C.fa V-C/index
+ bwa index V-C/index
+ rm V-C/index
degap: V-C.fa V_after_C.fa J_before_FGxG.fa J-FGxG.fa
for FA in V-C.fa V_after_C.fa J_before_FGxG.fa J-FGxG.fa ; do \
@@ -17,4 +17,4 @@ refresh-data:
R CMD BATCH --no-save J_before_FGxG.R
clean:
- @rm --force --verbose V/index.* V_after_C.Rout J_before_FGxG.Rout
+ @rm --force --verbose V-C/index.* V_after_C.Rout J_before_FGxG.Rout
diff --git a/references/V-C/index.amb b/references/V-C/index.amb
new file mode 100644
index 0000000..353dee2
--- /dev/null
+++ b/references/V-C/index.amb
@@ -0,0 +1 @@
+55126 169 0
diff --git a/references/V-C/index.ann b/references/V-C/index.ann
new file mode 100644
index 0000000..1d5538b
--- /dev/null
+++ b/references/V-C/index.ann
@@ -0,0 +1,339 @@
+55126 169 11
+0 TRAV1 (null)
+0 321 0
+0 TRAV2 (null)
+321 315 0
+0 TRAV3-1 (null)
+636 407 0
+0 TRAV4-1 (null)
+1043 317 0
+0 TRAV5-1 (null)
+1360 333 0
+0 TRAV6-1 (null)
+1693 327 0
+0 TRAV7-1 (null)
+2020 326 0
+0 TRAV6-2 (null)
+2346 330 0
+0 TRAV7D-2 (null)
+2676 327 0
+0 TRAV4D-2 (null)
+3003 321 0
+0 TRAV6D-3 (null)
+3324 327 0
+0 TRAV7D-3 (null)
+3651 327 0
+0 TRAV6D-4 (null)
+3978 329 0
+0 TRAV7D-4 (null)
+4307 327 0
+0 TRAV8D-1 (null)
+4634 327 0
+0 TRAV9D-1 (null)
+4961 327 0
+0 TRAV6D-5 (null)
+5288 327 0
+0 TRAV10D (null)
+5615 322 0
+0 TRAV6D-6 (null)
+5937 337 0
+0 TRAV13D-1 (null)
+6274 313 0
+0 TRAV15D-1/DV6D-1 (null)
+6587 336 0
+0 TRAV3D-2 (null)
+6923 328 0
+0 TRAV9D-2 (null)
+7251 330 0
+0 TRAV4D-3 (null)
+7581 318 0
+0 TRAV5D-2 (null)
+7899 281 0
+0 TRAV12D-2 (null)
+8180 327 0
+0 TRAV9D-3 (null)
+8507 330 0
+0 TRAV5D-3 (null)
+8837 212 0
+0 TRAV12D-3 (null)
+9049 331 0
+0 TRAV15D-2/DV6-2 (null)
+9380 326 0
+0 TRAV9D-4 (null)
+9706 220 0
+0 TRAV4D-4 (null)
+9926 319 0
+0 TRAV5D-4 (null)
+10245 337 0
+0 TRAV6D-7 (null)
+10582 324 0
+0 TRAV7D-6 (null)
+10906 324 0
+0 TRAV13D-3 (null)
+11230 327 0
+0 TRAV8D-2 (null)
+11557 327 0
+0 TRAV16D/DV11 (null)
+11884 312 0
+0 TRAV13D-4 (null)
+12196 327 0
+0 TRAV14D-3/DV8 (null)
+12523 351 0
+0 TRAV15D-3 (null)
+12874 218 0
+0 TRAV7N-4 (null)
+13092 326 0
+0 TRAV9N-1 (null)
+13418 321 0
+0 TRAV6N-5 (null)
+13739 325 0
+0 TRAV10N (null)
+14064 322 0
+0 TRAV6N-6 (null)
+14386 330 0
+0 TRAV11N (null)
+14716 333 0
+0 TRAV7N-5 (null)
+15049 319 0
+0 TRAV12N-1 (null)
+15368 330 0
+0 TRAV13N-1 (null)
+15698 321 0
+0 TRAV14N-1 (null)
+16019 354 0
+0 TRAV15N-1 (null)
+16373 336 0
+0 TRAV3N-2 (null)
+16709 324 0
+0 TRAV9N-2 (null)
+17033 330 0
+0 TRAV4N-3 (null)
+17363 321 0
+0 TRAV5N-2 (null)
+17684 277 0
+0 TRAV12N-2 (null)
+17961 333 0
+0 TRAV9N-3 (null)
+18294 330 0
+0 TRAV5N-3 (null)
+18624 270 0
+0 TRAV12N-3 (null)
+18894 336 0
+0 TRAV13N-2 (null)
+19230 321 0
+0 TRAV14N-2 (null)
+19551 354 0
+0 TRAV15N-2 (null)
+19905 336 0
+0 TRAV3N-3 (null)
+20241 333 0
+0 TRAV9N-4 (null)
+20574 330 0
+0 TRAV4N-4 (null)
+20904 321 0
+0 TRAV5N-4 (null)
+21225 337 0
+0 TRAV6N-7 (null)
+21562 357 0
+0 TRAV7N-6 (null)
(Diff truncated)
Replace slashes by wildcards in EMBOSS USA passed to seqret.
EMBOSS 6.6.6 converts slashes to underscores on the fly. Not sure for
earlier versions.
For example TRAV14D-3/DV8 is converted to TRAV14D-3_DV8, but them
match TRAV14D-3?DV8.
EMBOSS 6.6.6 converts slashes to underscores on the fly. Not sure for
earlier versions.
For example TRAV14D-3/DV8 is converted to TRAV14D-3_DV8, but them
match TRAV14D-3?DV8.
diff --git a/scripts/VJsplit b/scripts/VJsplit
index d1433f5..4b23919 100755
--- a/scripts/VJsplit
+++ b/scripts/VJsplit
@@ -49,7 +49,7 @@ do
VECTORSTRIP_V_OUTFILE=$LIBRARY.${V_NAME//\//}.vectorstrip
fi
echo -ne "$V_NAME\t" 1>&2
- V_SEQ=$(seqret -filter $CLONOTYPER_REFERENCE/${V_LIB}-C.fa:$V_NAME[-20:] raw:stdout)
+ V_SEQ=$(seqret -filter $CLONOTYPER_REFERENCE/${V_LIB}-C.fa:${V_NAME//\//?}[-20:] raw:stdout)
# Encode the mapping quality and alignment score in the sequence name
samtools view $EXTRACT_DIR/$LIBRARY.bam $V_NAME |
perl -ne '($score) = /AS:i:(\d+)\t/ ; ($mapq) = (split)[4] ; print "AS_${score}_MQ_${mapq}_$_"' > $LIBRARY-${V_NAME//\//}-filtered.sam
Uppercase final letter in 'clonotypeR'.
diff --git a/vignettes/clonotypeR.Rmd b/vignettes/clonotypeR.Rmd
index 19da4f5..8679d56 100644
--- a/vignettes/clonotypeR.Rmd
+++ b/vignettes/clonotypeR.Rmd
@@ -126,13 +126,13 @@ of the display).
### Detection of V segments
-Run the command `clonotyper detect A.fastq` in the same directory as a copy of
+Run the command `clonotypeR detect A.fastq` in the same directory as a copy of
the file `A.fastq`.
The result is stored in a temporary directory called `extraction_files`, that
will be created if it does not already exist.
-`clonotyper detect` compares the sequences to the reference V segments using
+`clonotypeR detect` compares the sequences to the reference V segments using
BWA, and produces output like the following.
[bsw2_aln] read 2000 sequences/pairs (843395 bp)...
@@ -146,13 +146,13 @@ pairs in total. There were 167 reference V segments, and the version number of
BWA was `0.6.2-r126`. The whole process took less than 10 seconds.
Process the example libraries `B` and `C` similarly with the commands
-`clonotyper detect B.fastq` and `clonotyper detect C.fastq`.
+`clonotypeR detect B.fastq` and `clonotypeR detect C.fastq`.
### Extraction of CDR3 regions
-Run the command `clonotyper extract A` in the same directory as where you ran
-`clonotyper detect A.fastq`. The result is a table stored in a directory
+Run the command `clonotypeR extract A` in the same directory as where you ran
+`clonotypeR detect A.fastq`. The result is a table stored in a directory
called `clonotypes`, that will be created if it does not already exist.
The output is quite voluminous, and indicates which *V* / *J* combinations are
Corrected a typo.
diff --git a/vignettes/clonotypeR.Rmd b/vignettes/clonotypeR.Rmd index 32f4fe7..19da4f5 100644 --- a/vignettes/clonotypeR.Rmd +++ b/vignettes/clonotypeR.Rmd @@ -146,7 +146,7 @@ pairs in total. There were 167 reference V segments, and the version number of BWA was `0.6.2-r126`. The whole process took less than 10 seconds. Process the example libraries `B` and `C` similarly with the commands -`clonotyper detect C.fastq` and `clonotyper detect C.fastq`. +`clonotyper detect B.fastq` and `clonotyper detect C.fastq`. ### Extraction of CDR3 regions
Commit made by the Bioconductor Git-SVN bridge.
Consists of 1 commit.
Commit information:
SVN Revision number: 94512
Commit message:
Updated data to test Git-SVN bridge.
Committed by c.plessy
Committed at: 2014-09-25T04:14:48.978745Z
Consists of 1 commit.
Commit information:
SVN Revision number: 94512
Commit message:
Updated data to test Git-SVN bridge.
Committed by c.plessy
Committed at: 2014-09-25T04:14:48.978745Z
diff --git a/DESCRIPTION b/DESCRIPTION index 8e69f9b..3370138 100644 --- a/DESCRIPTION +++ b/DESCRIPTION @@ -2,7 +2,7 @@ Package: clonotypeR Type: Package Title: High throughput analysis of T cell antigen receptor sequences Version: 1.3.1 -Date: 2014-04-08 +Date: 2014-09-25 Author: Charles Plessy <plessy@riken.jp> Maintainer: Charles Plessy <plessy@riken.jp> Description: High throughput analysis of T cell antigen receptor sequences
Updated data to test Git-SVN bridge.
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@94512 bc3139a8-67e5-0310-9ffc-ced21a209358
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@94512 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/DESCRIPTION b/DESCRIPTION index 8e69f9b..3370138 100644 --- a/DESCRIPTION +++ b/DESCRIPTION @@ -2,7 +2,7 @@ Package: clonotypeR Type: Package Title: High throughput analysis of T cell antigen receptor sequences Version: 1.3.1 -Date: 2014-04-08 +Date: 2014-09-25 Author: Charles Plessy <plessy@riken.jp> Maintainer: Charles Plessy <plessy@riken.jp> Description: High throughput analysis of T cell antigen receptor sequences
Commit made by the Bioconductor Git-SVN bridge.
Consists of 2 commits.
Commit information:
Commit id: 51fb79220208de9e7ca472345e524c8b40a3654d
Merge branch 'master' of github.com:charles-plessy/clonotypeR
Committed by: Bioconductor Git-SVN Bridge
Author Name: Bioconductor Git-SVN Bridge
Commit date: 2014-09-24 21:14:00 -0700
Author date: 2014-09-24 21:14:00 -0700
Commit id: ecd472cb2a5a17a4ebe7821a80961252b1b5796b
More spellchecking.
This also tests the Git-SVN bridge.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-09-25 13:09:33 +0900
Author date: 2014-09-25 13:09:33 +0900
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@94511 bc3139a8-67e5-0310-9ffc-ced21a209358
Consists of 2 commits.
Commit information:
Commit id: 51fb79220208de9e7ca472345e524c8b40a3654d
Merge branch 'master' of github.com:charles-plessy/clonotypeR
Committed by: Bioconductor Git-SVN Bridge
Author Name: Bioconductor Git-SVN Bridge
Commit date: 2014-09-24 21:14:00 -0700
Author date: 2014-09-24 21:14:00 -0700
Commit id: ecd472cb2a5a17a4ebe7821a80961252b1b5796b
More spellchecking.
This also tests the Git-SVN bridge.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-09-25 13:09:33 +0900
Author date: 2014-09-25 13:09:33 +0900
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@94511 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/vignettes/clonotypeR.Rmd b/vignettes/clonotypeR.Rmd
index 3de0e56..32f4fe7 100644
--- a/vignettes/clonotypeR.Rmd
+++ b/vignettes/clonotypeR.Rmd
@@ -57,7 +57,7 @@ library(clonotypeR)
The data is a table of 120 clonotypes in the `extdata` folder of the package.
The command `read_clonotypes` will parse it in a data frame. The clonotypes
-are arbitrarly assigned to three libraries called `A`, `B`, and `C`. The
+are arbitrarily assigned to three libraries called `A`, `B`, and `C`. The
`read_clonotypes` comments determines at load time if the peptidic sequence has
a stop codon or is frame-shifted, and records the information in the
`unproductive` column.
@@ -78,7 +78,7 @@ head(clonotype_table(levels(clonotypes$lib), "J", data=clonotypes))
```
ClonotypeR provides other functions for further analysis. `yassai_identifier`
-calculates a unique indentifier using the `V`, `J`, peptidic and nucleotidic
+calculates a unique identifier using the `V`, `J`, peptidic and nucleotidic
information, following the work of [Yassai et al](http://dx.doi.org/10.1007/s00251-009-0383-x).
```{r yassai_identifier}
@@ -100,7 +100,7 @@ common_clonotypes(data=clonotypes)
```
With deeper data, a typical follow-up would be to identify differentially
-represnted clonotypes between libraries, for instance with the `edgeR` package,
+represented clonotypes between libraries, for instance with the `edgeR` package,
or to calculate distance between libraries, for instance with the
`vegan` package.
@@ -109,7 +109,7 @@ Example data (3 x 2,000 reads)
------------------------------
The data provided on-line at <http://clonotyper.branchable.com/example_data/>
-is a sub-sample of three sequence librairies of mouse T cell receptors α (2,000
+is a sub-sample of three sequence libraries of mouse T cell receptors α (2,000
reads each) made on the 454 Titanium or the 454 junior platforms. The original
libraries will be deposited in public databanks after publication in a
peer-reviewed journal.
@@ -210,7 +210,7 @@ The command `summary(clonotypes)` already provides useful information.
summary(clonotypes)
```
-Identify unique clonotypes, count their sequences in the libraries `A`, `B` and `C`, and store the result as a table arbitrarly named `abc`.
+Identify unique clonotypes, count their sequences in the libraries `A`, `B` and `C`, and store the result as a table arbitrarily named `abc`.
```{r explore_data2}
abc <- clonotype_table(c('A','B','C'), data=clonotypes)
Revert merge with the branch containing the wiki and the bash scripts.
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@94510 bc3139a8-67e5-0310-9ffc-ced21a209358
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@94510 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/Bugs.mdwn b/Bugs.mdwn
deleted file mode 100644
index 1106591..0000000
--- a/Bugs.mdwn
+++ /dev/null
@@ -1,12 +0,0 @@
-If you've found a bug in clonotypeR, post about it here. [[TODO]] items go
-elsewhere. Link items to [[Bugs/done]] when done.
-
-The [[!shortcut name=commit url="http://source.clonotyper.branchable.com/?p=source.git;a=commitdiff;h=%s"]].
-You can use it to link to the commit that fixed the bug, as in `\[[!commit 7cf11805d84ff8dc6a537c17e73efa275077915d]]`.
-
-There are [[!pagecount pages="Bugs/* and !Bugs/done and !Bugs/discussion and
-!link(patch) and !link(Bugs/done) and !Bugs/*/*"]] "open" bugs:
-
-[[!inline pages="Bugs/* and !Bugs/done and !Bugs/discussion and
-!link(patch) and !link(Bugs/done) and !Bugs/*/*"
-actions=yes rootpage="Bugs" postformtext="Add a new bug titled:" show=0]]
diff --git a/Bugs/Clonotype_that_takes_ages_for_calculating_the_Yassai_identifier..mdwn b/Bugs/Clonotype_that_takes_ages_for_calculating_the_Yassai_identifier..mdwn
deleted file mode 100644
index 7cdfc91..0000000
--- a/Bugs/Clonotype_that_takes_ages_for_calculating_the_Yassai_identifier..mdwn
+++ /dev/null
@@ -1,55 +0,0 @@
-Problem
--------
-
-<pre>
-yassai_identifier(c(V="TRAV14N-3", J="TRAJ16", dna="GCAACTTCAAGTGGCCAGAAGCTGGTT", pep="ATSSGQKLV"))
-# takes ages
-
-yassai_identifier(c(V="TRAV14N-3", J="TRAJ16", dna="GCAGCAACCGCAACTTCAAGTGGCCAGAAGCTGGTT", pep="AATATSSGQKLV"))
-## [1] "aTa.2A14N3A16L12"
-# returns immediately.
-</pre>
-
-
-Troubleshooting
----------------
-
-The problematic clonotype comes from read `GWYEMNS10GHZUF`.
-
-<pre>
-@GWYEMNS10GHZUF
-gactAACTGGTACACAGCAGGTTCTGGGTTCTGGATGTGCAGGTACACCTTTAATATGGTCCCCTGGCCAAAAACCAGCTTCTGGCCACTTGAAGTTGCACAGAAGTAGGTGGCTGAGTCTCCAGGCTGAGAGTCTTTGATGTGCAAGGAGAGATTTTTCTCCCTTTTATTGAAGAAGATTGTGAATCGTCCATCTTCCTTTTTATCGGACACTGAACGTATGGCTATCAGGAGAGCAGGGCCTTCCCCAGGGAACTGCTGGTACCATGGGAAGTAGTCAAAAGCACTGTTCTCAtaactagcagttcagaattgcggtctctccttccccagactgtcagagattggagtcgtgggagacaaggcacacaggggataggngngnnnnnnnnnnnnn
-+
-FFF::;;FFFFFFFFIIIIHFFFHF666=<FFGGDDDFFHFDIIIIIIIHHHIIIHFFFD54449662200001335>>AAABDFDDDFDDDFFFFFFFFFFFFFFFFFCCCCCFFFFFFFFFFFFDDBBBBB==110?@@@@@>4455BBA??3357;F4:::;;==D88?AA<;:==BAAAA==??AAB@AAA=>>>222//02A8898BDDFFFDDFFFFFF666:DBAAAABB:::???DD;;;;D?????DDBA?<<<><<<<000444<8993222233393...:663322<9233776899:;;963326755551111,,,,3313335333799.....23322666726;;;66772222,,,,47400!,!,!!!!!!!!!!!!!
-</pre>
-
-Here is the alignment made by clonotypeR
-
-<pre>
-GWYEMNS10GHZUF 16 TRAV14N-3 105 17 49S17M1I29M1I201M99S * 0 0 NNNNNNNNNNNNNCNCNCCTATCCCCTGTGTGCCTTGTCTCCCACGACTCCAATCTCTGACAGTCTGGGGAAGGAGAGACCGCAATTCTGAACTGCTAGTTATGAGAACAGTGCTTTTGACTACTTCCCATGGTACCAGCAGTTCCCTGGGGAAGGCCCTGCTCTCCTGATAGCCATACGTTCAGTGTCCGATAAAAAGGAAGATGGACGATTCACAATCTTCTTCAATAAAAGGGAGAAAAATCTCTCCTTGCACATCAAAGACTCTCAGCCTGGAGACTCAGCCACCTACTTCTGTGCAACTTCAAGTGGCCAGAAGCTGGTTTTTGGCCAGGGGACCATATTAAAGGTGTACCTGCACATCCAGAACCCAGAACCTGCTGTGTACCAGTTAGTC !!!!!!!!!!!!!,!,!00474,,,,22227766;;;62766622332.....9973335333133,,,,111155557623369;;:9986773329<223366:...3933322223998<444000<<<<><<<?ABDD?????D;;;;DD???:::BBAAAABD:666FFFFFFDDFFFDDB8988A20//222>>>=AAA@BAA??==AAAAB==:;<AA?88D==;;:::4F;7533??ABB5544>@@@@@?011==BBBBBDDFFFFFFFFFFFFCCCCCFFFFFFFFFFFFFFFFFDDDFDDDFDBAAA>>53310000226694445DFFFHIIIHHHIIIIIIIDFHFFDDDGGFF<=666FHFFFHIIIIFFFFFFFF;;::FFF AS:i:233 XS:i:218 XF:i:3 XE:i:4 XN:i:0
-</pre>
-
-The problem was that the V segment was completely digested in favor of the J segment.
-
-<pre>
- 351 400
-GWYEMNS10GHZUF CTGTGCAACTTCAAGTGGCCAGAAGCTGGTTTTTGGCCAGGGGACCATAT
-TRAJ16 ~~~~GCAACTTCAAGTGGCCAGAAGCTGGTTTTTGGCCAGGGGACCATAT
-TRAV14N-3 CTGTGCAGC...AAGTG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
-
- 401 450
-GWYEMNS10GHZUF TAAAGGTGTACCTGCACATCCAGAACCCAGAACCTGCTGTGTACCAGTTA
-TRAJ16 TAAAGGTGTACCTGC~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
-TRAV14N-3 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
-</pre>
-
-This triggered an infinite loop when calling `is.germline()`.
-
-[[Done]] in `42ab98729c5c77462b5929b00ee973074ae4c1c7`.
-
-Now the function should return as in the following example.
-
-<pre>
-yassai_identifier(c(V="TRAV14N-3", J="TRAJ16", dna="GCAACTTCAAGTGGCCAGAAGCTGGTT", pep="ATSSGQKLV"))
-## [1] "a.A14N3A16L9"
-</pre>
diff --git a/Bugs/Different_clonotypes_give_the_same_Yassai_identifier..mdwn b/Bugs/Different_clonotypes_give_the_same_Yassai_identifier..mdwn
deleted file mode 100644
index a4efb15..0000000
--- a/Bugs/Different_clonotypes_give_the_same_Yassai_identifier..mdwn
+++ /dev/null
@@ -1,31 +0,0 @@
-Is it a bug in the software or a bug in the concept ?
-
-<pre>
-> rownames(dd)[grep('aAn.1A14-1A43L9', dd.yassai)]
-[1] "TRAV14-1 TRAJ43 GCAGCAGCTAACAACAATGCCCCACGA AAANNNAPR"
-[2] "TRAV14-1 TRAJ43 GCAGCTAATAACAACAATGCCCCACGA AANNNNAPR"
-> V_after_C['TRAV14-1',]
-[1] "GCAGCAAGTG"
-> J_before_FGxG['TRAJ43',]
-[1] "GCAATAACAACAATGCCCCACGA"
-</pre>
-
-<pre>
-aAn.1A14-1A43L9
- A A A N N N A P R
-GCA GCA GCT AAC AAC AAT GCC CCA CGA
-GCA GCA agt g
- gc aaT AAC AAC AAT GCC CCA CGA
-</pre>
-
-<pre>
-aAn.1A14-1A43L9
- A A N N N N A P R
-GCA GCT AAT AAC AAC AAT GCC CCA CGA
-GCA GCa agt g
- gc AAT AAC AAC AAT GCC CCA CGA
-</pre>
-
-----
-
-This is a collision (different colonotypes giving the same Yassai ID) rather than a bug in the implementation → [[done]].
diff --git a/Bugs/Does_not_work_with_EMBOSS_6.6.0..mdwn b/Bugs/Does_not_work_with_EMBOSS_6.6.0..mdwn
deleted file mode 100644
index c95cbe8..0000000
--- a/Bugs/Does_not_work_with_EMBOSS_6.6.0..mdwn
+++ /dev/null
@@ -1,18 +0,0 @@
-The reason is the following bug in EMBOSS.
-
-<pre>
-echo -e '>A\nAAAAAA' > test-1.fa
-cat test-1.fa
-# >A
-# AAAAAA
-seqret test-1.fa:A stdout
-# Read and write (return) sequences
-# >A
-# AAAAAA
-mkdir test
-seqret test-1.fa:A stdout
-# Read and write (return) sequences
-# Error: Query 'test-1.fa:A' query field '1.fa' not defined for datatype 'sequence'
-# Error: Unable to read sequence 'test-1.fa:A'
-# Died: seqret terminated: Bad value for '-sequence' and no prompt
-</pre>
diff --git a/Bugs/Incorrect_identifiers_when_V-J_boundary_is_a_codon_boundary_.mdwn b/Bugs/Incorrect_identifiers_when_V-J_boundary_is_a_codon_boundary_.mdwn
deleted file mode 100644
index 1648dce..0000000
--- a/Bugs/Incorrect_identifiers_when_V-J_boundary_is_a_codon_boundary_.mdwn
+++ /dev/null
@@ -1,13 +0,0 @@
-<pre>
-> yassai_identifier(c(V='TRAV2', J='TRAJ61', dna='ATTGTGACTGACACAGGTACAGAATTAATAGGAAATTGGCA', pep='IVTDTGTELIGNW'))
-[1] "tg.integer(0)A2A61L13"
-</pre>
-
-[[Done]] in `2b8514d18f312f627255b0f2eb0ec1bf4ffa48dd`, by return an empty chain instead of `integer(0)` when receiving an empty chain.
-
-Result after correction:
-
-<pre>
-> yassai_identifier(c(V='TRAV2', J='TRAJ61', dna='ATTGTGACTGACACAGGTACAGAATTAATAGGAAATTGGCA', pep='IVTDTGTELIGNW'))
-[1] "tg.A2A61L13"
-</pre>
diff --git a/Bugs/Use_basename_case-insensitively.mdwn b/Bugs/Use_basename_case-insensitively.mdwn
deleted file mode 100644
index 95a3173..0000000
--- a/Bugs/Use_basename_case-insensitively.mdwn
+++ /dev/null
@@ -1,6 +0,0 @@
-Problem:
-
- $ basename foo.fastq .fastq
- foo
- $ basename foo.FASTQ .fastq
- foo.FASTQ
diff --git a/Bugs/clonotypeR_detect_should_test_the_existence_of_the_FASTQ_file..mdwn b/Bugs/clonotypeR_detect_should_test_the_existence_of_the_FASTQ_file..mdwn
deleted file mode 100644
index 3899e4e..0000000
--- a/Bugs/clonotypeR_detect_should_test_the_existence_of_the_FASTQ_file..mdwn
+++ /dev/null
@@ -1,18 +0,0 @@
-This would prevent horrors like:
-
-<pre>
-$ ../scripts/clonotypeR detect .fastq
-[bam_header_read] EOF marker is absent. The input is probably truncated.
-[bsw2_aln] fail to open file '.fastq'. Abort!
-[samopen] SAM header is present: 169 sequences.
-[sam_read1] reference 'SN:TRDV5 LN:344
-3
-
-19
-
-3
-
-
-' is recognized as '*'.
-[main_samview] truncated file.
-</pre>
diff --git a/Bugs/done.mdwn b/Bugs/done.mdwn
deleted file mode 100644
index 0a666ab..0000000
--- a/Bugs/done.mdwn
+++ /dev/null
(Diff truncated)
More spellchecking.
This also tests the Git-SVN bridge.
This also tests the Git-SVN bridge.
diff --git a/vignettes/clonotypeR.Rmd b/vignettes/clonotypeR.Rmd
index 3de0e56..32f4fe7 100644
--- a/vignettes/clonotypeR.Rmd
+++ b/vignettes/clonotypeR.Rmd
@@ -57,7 +57,7 @@ library(clonotypeR)
The data is a table of 120 clonotypes in the `extdata` folder of the package.
The command `read_clonotypes` will parse it in a data frame. The clonotypes
-are arbitrarly assigned to three libraries called `A`, `B`, and `C`. The
+are arbitrarily assigned to three libraries called `A`, `B`, and `C`. The
`read_clonotypes` comments determines at load time if the peptidic sequence has
a stop codon or is frame-shifted, and records the information in the
`unproductive` column.
@@ -78,7 +78,7 @@ head(clonotype_table(levels(clonotypes$lib), "J", data=clonotypes))
```
ClonotypeR provides other functions for further analysis. `yassai_identifier`
-calculates a unique indentifier using the `V`, `J`, peptidic and nucleotidic
+calculates a unique identifier using the `V`, `J`, peptidic and nucleotidic
information, following the work of [Yassai et al](http://dx.doi.org/10.1007/s00251-009-0383-x).
```{r yassai_identifier}
@@ -100,7 +100,7 @@ common_clonotypes(data=clonotypes)
```
With deeper data, a typical follow-up would be to identify differentially
-represnted clonotypes between libraries, for instance with the `edgeR` package,
+represented clonotypes between libraries, for instance with the `edgeR` package,
or to calculate distance between libraries, for instance with the
`vegan` package.
@@ -109,7 +109,7 @@ Example data (3 x 2,000 reads)
------------------------------
The data provided on-line at <http://clonotyper.branchable.com/example_data/>
-is a sub-sample of three sequence librairies of mouse T cell receptors α (2,000
+is a sub-sample of three sequence libraries of mouse T cell receptors α (2,000
reads each) made on the 454 Titanium or the 454 junior platforms. The original
libraries will be deposited in public databanks after publication in a
peer-reviewed journal.
@@ -210,7 +210,7 @@ The command `summary(clonotypes)` already provides useful information.
summary(clonotypes)
```
-Identify unique clonotypes, count their sequences in the libraries `A`, `B` and `C`, and store the result as a table arbitrarly named `abc`.
+Identify unique clonotypes, count their sequences in the libraries `A`, `B` and `C`, and store the result as a table arbitrarily named `abc`.
```{r explore_data2}
abc <- clonotype_table(c('A','B','C'), data=clonotypes)
Commit made by the Bioconductor Git-SVN bridge.
Consists of 2 commits.
Commit information:
Commit id: 4e7034c69e443882fca6fe517088d3ac3658a6d0
Merge branch 'master' of github.com:charles-plessy/clonotypeR
Committed by: Bioconductor Git-SVN Bridge
Author Name: Bioconductor Git-SVN Bridge
Commit date: 2014-09-24 21:04:48 -0700
Author date: 2014-09-24 21:04:48 -0700
Commit id: 5ed6cd02c7cd5701860ff1d20e80f509aa64bd96
Checked spelling.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-09-25 13:03:28 +0900
Author date: 2014-09-25 13:03:28 +0900
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@94509 bc3139a8-67e5-0310-9ffc-ced21a209358
Consists of 2 commits.
Commit information:
Commit id: 4e7034c69e443882fca6fe517088d3ac3658a6d0
Merge branch 'master' of github.com:charles-plessy/clonotypeR
Committed by: Bioconductor Git-SVN Bridge
Author Name: Bioconductor Git-SVN Bridge
Commit date: 2014-09-24 21:04:48 -0700
Author date: 2014-09-24 21:04:48 -0700
Commit id: 5ed6cd02c7cd5701860ff1d20e80f509aa64bd96
Checked spelling.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-09-25 13:03:28 +0900
Author date: 2014-09-25 13:03:28 +0900
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@94509 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/man/common_clonotypes.Rd b/man/common_clonotypes.Rd
index 3d239ca..9005ee0 100644
--- a/man/common_clonotypes.Rd
+++ b/man/common_clonotypes.Rd
@@ -29,7 +29,7 @@ quantitatively the overlap between each pair of libraries.
\arguments{
\item{group1}{A character vector containing clonotype library names.}
\item{group2}{A character vector containing clonotype library names.}
- \item{mode}{Only when producing a matrix of pairwise comparisions: \dQuote{count} (default) or \dQuote{abundance}, see below.}
+ \item{mode}{Only when producing a matrix of pairwise comparisons: \dQuote{count} (default) or \dQuote{abundance}, see below.}
\item{data}{A clonotype table where the data is stored.}
}
Checked spelling.
diff --git a/man/common_clonotypes.Rd b/man/common_clonotypes.Rd
index 3d239ca..9005ee0 100644
--- a/man/common_clonotypes.Rd
+++ b/man/common_clonotypes.Rd
@@ -29,7 +29,7 @@ quantitatively the overlap between each pair of libraries.
\arguments{
\item{group1}{A character vector containing clonotype library names.}
\item{group2}{A character vector containing clonotype library names.}
- \item{mode}{Only when producing a matrix of pairwise comparisions: \dQuote{count} (default) or \dQuote{abundance}, see below.}
+ \item{mode}{Only when producing a matrix of pairwise comparisons: \dQuote{count} (default) or \dQuote{abundance}, see below.}
\item{data}{A clonotype table where the data is stored.}
}
Commit made by the Bioconductor Git-SVN bridge.
Consists of 2 commits.
Commit information:
Commit id: c32c335cc2b3817a74e1129d81d775dfd6a19f61
Merge branch 'master' of github.com:charles-plessy/clonotypeR
Committed by: Bioconductor Git-SVN Bridge
Author Name: Bioconductor Git-SVN Bridge
Commit date: 2014-09-24 20:29:00 -0700
Author date: 2014-09-24 20:29:00 -0700
Commit id: e2388f68d34bcb0b1d72475237341782eed2479c
Explicitely import setMethod in NAMESPACE.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-09-25 11:27:33 +0900
Author date: 2014-09-25 11:27:33 +0900
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@94507 bc3139a8-67e5-0310-9ffc-ced21a209358
Consists of 2 commits.
Commit information:
Commit id: c32c335cc2b3817a74e1129d81d775dfd6a19f61
Merge branch 'master' of github.com:charles-plessy/clonotypeR
Committed by: Bioconductor Git-SVN Bridge
Author Name: Bioconductor Git-SVN Bridge
Commit date: 2014-09-24 20:29:00 -0700
Author date: 2014-09-24 20:29:00 -0700
Commit id: e2388f68d34bcb0b1d72475237341782eed2479c
Explicitely import setMethod in NAMESPACE.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-09-25 11:27:33 +0900
Author date: 2014-09-25 11:27:33 +0900
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@94507 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/DESCRIPTION b/DESCRIPTION
index c73ec16..8e69f9b 100644
--- a/DESCRIPTION
+++ b/DESCRIPTION
@@ -15,7 +15,7 @@ Description: High throughput analysis of T cell antigen receptor sequences
The purpose of this package is to process and quantitatively analyse millions
of V-CDR3-J combination, called clonotypes, from multiple sequence libraries.
License: file LICENSE
-Depends: methods
+Imports: methods
Suggests: BiocGenerics, edgeR, knitr, pvclust, RUnit, vegan
VignetteBuilder: knitr
Packaged: 2013-12-11 10:22:39 UTC; charles
diff --git a/NAMESPACE b/NAMESPACE
index d75f824..2d083c2 100644
--- a/NAMESPACE
+++ b/NAMESPACE
@@ -1 +1,2 @@
+importFrom(methods, setMethod)
exportPattern("^[[:alpha:]]+")
Commit made by the Bioconductor Git-SVN bridge.
Consists of 380 commits.
Commit information:
Commit id: de449193bde6e56a204d3b12c7f4e489a780e4b2
Merge branch 'bioc'
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-09-25 11:00:49 +0900
Author date: 2014-09-25 11:00:49 +0900
Commit id: 0838bc06272e87c0690f093a017cde8a9cc10313
News entry for the new stable release.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-06-05 19:40:12 +0900
Author date: 2014-06-05 19:40:12 +0900
Commit id: 67aa2eac309df5bf8d5dbc790661db102145d692
Does not work with EMBOS 6.6.0.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2014-06-05 05:22:35 +0000
Author date: 2014-06-05 05:22:35 +0000
Commit id: fe4ae4f131d3c5fc8d5aebd5873d7de109c1b0b7
Should use `basename` canse-insensitively…
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2014-06-04 22:38:29 +0000
Author date: 2014-06-04 22:38:29 +0000
Commit id: 517e35af4a8ad194bed6ea3d187c73e5b97490b7
Merge branch 'bioc'
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-04-09 12:45:46 +0900
Author date: 2014-04-09 12:45:46 +0900
Commit id: 23598ee1b592a99be9cf58602b0f214c2980453a
Merge branch 'bioc'
Conflicts:
DESCRIPTION
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-04-08 15:45:15 +0900
Author date: 2014-04-08 15:45:15 +0900
Commit id: d404d2c8f9b682404b64d2d5e8deb29954edc499
Merge branch 'bioc'
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-04-03 14:03:24 +0900
Author date: 2014-04-03 14:03:24 +0900
Commit id: bd21f9c77e7083e183d22287c4f79e8c6161d62e
Documentation updates.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-04-03 14:02:11 +0900
Author date: 2014-04-03 14:02:11 +0900
Commit id: 8a633d4908bd1176d9dced6ba47acfc469aa7a3f
Merge branch 'bioc'
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-04-03 13:49:30 +0900
Author date: 2014-04-03 13:49:30 +0900
Commit id: bb7e511573b44b0ecd95e5d643dceb6adcc103a2
Merge branch 'bioc'
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-04-03 13:19:06 +0900
Author date: 2014-04-03 13:19:06 +0900
Commit id: de328b9f0a5035662eb934d79dd876ae72a1ba0b
Merge branch 'master' of ssh://clonotyper.branchable.com
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-04-03 11:28:17 +0900
Author date: 2014-04-03 11:28:17 +0900
Commit id: d16322c96db5046f113bfa982e8a621444324ab5
Merge branch 'bioc'
Conflicts:
DESCRIPTION
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-04-03 11:27:03 +0900
Author date: 2014-04-03 11:27:03 +0900
Commit id: 2767b62c7c87359ca87daaf28e4ec5dec44a5b6f
No full source archive available for the moment.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-12-19 16:21:39 +0000
Author date: 2013-12-19 16:21:39 +0000
Commit id: 56784b6503a5de8205789f19a23bbf40cf9750ea
Commited 1.1.3 to Bioconductor.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-12-11 19:27:09 +0900
Author date: 2013-12-11 19:27:09 +0900
Commit id: d2488356f56b6c332a4796d2d3f0245bfcc5e558
Indicate the position of the V-J junction when there is no codon ID to indicate.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-12-11 19:19:01 +0900
Author date: 2013-12-11 19:19:01 +0900
Commit id: ef4a8fe53efae1baa5df16677edbac30911463ff
Flag and exclude ambiguous DNA sequences.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-12-11 17:59:27 +0900
Author date: 2013-12-11 17:59:27 +0900
Commit id: fe95743d1153f6288c987a796ad710b6fba2f1c6
Merge branch 'master' of ssh://clonotyper.branchable.com
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-12-11 14:31:03 +0900
Author date: 2013-12-11 14:31:03 +0900
Commit id: 08727c97529f33931c5d13aeff3e16dc39c29ab7
Problem solved by better checking the input.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-12-11 05:29:37 +0000
Author date: 2013-12-11 05:29:37 +0000
Commit id: e4d102a595c15459574a5a175124aac69ac9952b
Added example.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-12-11 05:26:15 +0000
Author date: 2013-12-11 05:26:15 +0000
Commit id: 2b8514d18f312f627255b0f2eb0ec1bf4ffa48dd
Return empty chain instead of integer(0) when receiving an empty chain.
Closes: Incorrect_identifiers_when_V-J_boundary_is_a_codon_boundary_
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-12-11 14:26:05 +0900
Author date: 2013-12-11 14:26:05 +0900
Commit id: cb56f5611fc8532cac80bf527b1d9e8d8524586e
Broke the infinite loop.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-12-11 05:23:48 +0000
Author date: 2013-12-11 05:23:48 +0000
Commit id: bc0c6046cdfbb32a74a0741548015e01f0c5f659
Merge branch 'master' of ssh://clonotyper.branchable.com
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-12-11 14:21:45 +0900
Author date: 2013-12-11 14:21:45 +0900
Commit id: 42ab98729c5c77462b5929b00ee973074ae4c1c7
Break infinite loop when the whole CDR3 sequence is identical to the germline reference.
Closes: Clonotype_that_takes_ages_for_calculating_the_Yassai_identifier.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-12-11 14:19:17 +0900
Author date: 2013-12-11 13:33:04 +0900
Commit id: e6f8d079888dc3dcffe677ef1a042313fc03c817
Alignment to the J region is correct as well.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-12-05 08:23:41 +0000
Author date: 2013-12-05 08:23:41 +0000
Commit id: da4a4c5f6c41041d48fda34cb05ce8ba908cd47c
Alignment of the V region is correct.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-12-05 08:22:03 +0000
Author date: 2013-12-05 08:22:03 +0000
Commit id: 51e8e91ca69d36b2ec625de2b61c6c21d3663819
Escaped using the Highlight command
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-12-05 07:59:07 +0000
Author date: 2013-12-05 07:59:07 +0000
Commit id: eb7eaedbf22419eaa200afd8dd97d4ff7c1f782f
Alignment in SAM format.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-12-05 07:46:39 +0000
Author date: 2013-12-05 07:46:39 +0000
Commit id: a3b445a51fe755d691cf87b9533933d50c71ee94
Found the problematic read.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-12-05 07:44:59 +0000
Author date: 2013-12-05 07:44:59 +0000
Commit id: 47bba4876cbe49b3a6415bbb4f6f6a6a3007ce41
Found a clonotype that makes yassai_identifier() very slow.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-12-05 05:41:02 +0000
Author date: 2013-12-05 05:41:02 +0000
Commit id: 261d18f4a8f6a042c2d9602e352df47412bad27d
Refreshed documentation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-12-05 13:21:34 +0900
Author date: 2013-12-05 13:21:34 +0900
Commit id: 8b85bb373c930b6f1ef506b3ade2bbbc569d3775
New "long" option to yassai_identifier(), to avoid collisions.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-12-05 13:21:12 +0900
Author date: 2013-12-05 13:21:12 +0900
Commit id: 00f4895d4a172de8fd3109125fc1435e6b2d06a2
Cosmetic reorganisations.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-12-05 11:34:27 +0900
Author date: 2013-12-05 11:34:27 +0900
Commit id: 0ff5028ed5f320f1e5c75d4657f0bcee6c9c49dd
Simplification and standardisation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-12-05 11:22:40 +0900
Author date: 2013-12-05 11:22:40 +0900
Commit id: 2232d06fa83e353a95cc31851b904d19de8711d6
Another software for analysing TCRs.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-11-20 00:56:00 +0000
Author date: 2013-11-20 00:56:00 +0000
Commit id: 95b2833ad6e5882f1d3f34615830512b51db1da4
Actually, in this collision the translations are different.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-11-20 00:49:14 +0000
Author date: 2013-11-20 00:49:14 +0000
Commit id: baed72501169ddf3ff3d891131f2dfc73a366aec
Corrected aminoacid sequence. Finally, this is a collision.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-11-20 00:44:39 +0000
Author date: 2013-11-20 00:44:39 +0000
Commit id: c32e4a3cc8444cd5e593f1c31a7e359112fbd827
Latest versions on NCBI, updating TRDV5.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-11-19 20:33:32 +0900
Author date: 2013-11-19 19:47:15 +0900
Commit id: f4d3784867dfea3890eaed4612f99fd847c77915
Corrected a typo.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2013-11-19 10:32:20 +0000
Author date: 2013-11-19 10:32:20 +0000
Commit id: 3ca955591dfc25fc68d092b4943ed216ca8e821d
Not a bug.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-11-19 00:42:05 +0000
Author date: 2013-11-19 00:42:05 +0000
Commit id: 08d60b3329e96780e6ec1d339302b088f6ca7f60
Split by codons.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-11-19 00:34:29 +0000
Author date: 2013-11-19 00:34:29 +0000
Commit id: b60fca260bd7b9a65982123de01c7c42b1ba3daa
Different clonotypes give same ID ?
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2013-11-19 00:29:48 +0000
Author date: 2013-11-19 00:29:48 +0000
Commit id: d9b8de3e75728ad5b1d2a2155bd433843f4f1c8f
Bug in yassai_identifier()
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2013-11-18 10:42:49 +0000
Author date: 2013-11-18 10:42:49 +0000
Commit id: 606a691a190592d7cff6038811ebe0b1f04f0049
Corrected a typo.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-31 18:12:47 +0900
Author date: 2013-10-31 18:12:47 +0900
Commit id: 1784e2b9312999da0a70da26df0cadd0880494fc
clonotype_table: new option to randomly "sample" libraries.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-23 19:57:59 +0900
Author date: 2013-10-23 19:57:59 +0900
Commit id: 9ff7927026d58cd082f284097fec448118640f6b
No default table anymore.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-23 18:01:25 +0900
Author date: 2013-10-23 18:01:25 +0900
Commit id: 36f5e57c35b86a59329a33028b5cf8250af84def
Corrected minor formatting error in the documentation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-23 17:08:50 +0900
Author date: 2013-10-23 17:08:50 +0900
Commit id: 1702447155fa521184444ec18f7b3c54cbe27b38
Refreshed HTML documentation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-17 19:00:24 +0900
Author date: 2013-10-17 19:00:24 +0900
Commit id: 04608179a93c4f6710e92b8f48b8afe1070bf5c8
common_clonotypes: new mode to calculate the "abundance" relatively to one library.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-17 19:00:03 +0900
Author date: 2013-10-17 18:50:10 +0900
Commit id: 6df141e961f24c6c5cbfd4a0a13ca3eac7274b19
Double the speed, taking advantage of the symmetry.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-17 15:55:45 +0900
Author date: 2013-10-17 15:55:45 +0900
Commit id: 13e106a7bcf2bac307b74dbe37c347e391c76db0
Made common_clonotypes a S4 function.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-17 15:50:56 +0900
Author date: 2013-10-17 15:50:56 +0900
Commit id: 6db01d0bbb9476e645977090a7b0bec8e245ef9e
Merge branch 'master' of ssh://clonotyper.branchable.com
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-16 16:21:15 +0900
Author date: 2013-10-16 16:21:15 +0900
Commit id: a7f701ba0e21c8a801115c90c7d50b4f11f72f7c
New development branch.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-16 15:52:17 +0900
Author date: 2013-10-16 15:52:17 +0900
Commit id: 5ea2135a5e302b8adafcf7edb8012b6a471051d1
Point to the stable version of Bioconductor.
Committed by: admin
Author Name: https://plessy-riken-jp.myopenid.com/
Commit date: 2013-10-15 22:47:14 +0000
Author date: 2013-10-15 22:47:14 +0000
Commit id: 877d38c95c8e21f41747030426b4844f1600e945
Point to the stable version of Bioconductor.
Committed by: admin
Author Name: https://plessy-riken-jp.myopenid.com/
Commit date: 2013-10-15 22:46:35 +0000
Author date: 2013-10-15 22:46:35 +0000
Commit id: 17952327295bd9a862d9295db23b8dda4ebc9e46
Updating description and releasing 0.99.6.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-07 20:32:00 +0900
Author date: 2013-10-07 20:31:37 +0900
Commit id: 167637b6e6bbd928a3800d42518cb0ec93d32474
Correct syntax error.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-07 20:28:49 +0900
Author date: 2013-10-07 20:28:49 +0900
Commit id: 9e2e2de37a8d8aca10e2c07898b38a1059709bbe
Refreshed.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-07 20:27:26 +0900
Author date: 2013-10-07 20:27:26 +0900
Commit id: b3008e36c563446be4fb08cde93826059da07ce6
Mention Bioconductor on the front page.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-07 20:26:58 +0900
Author date: 2013-10-07 20:26:58 +0900
Commit id: 5796401be556310df17e32e4318d54ef7d7f85c7
Added unit tests for yassai_identifier(), and unbroke it by the way.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-07 19:55:01 +0900
Author date: 2013-10-07 19:55:01 +0900
Commit id: 1b0ed175787e98c38fea3fd8a5e5d6c8cd408545
Unbreak again the output when there is only one clonotype.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-07 19:44:50 +0900
Author date: 2013-10-07 19:44:50 +0900
Commit id: 5d9f507c1f2bc79148ce95ec33bc62c3b2a5ca2c
Corrected minor syntax error.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-07 19:28:32 +0900
Author date: 2013-10-07 19:28:32 +0900
Commit id: 246b1e3ed20695e559bba51356a2a7cc9ce60c25
The `R` package is also distributed on Bioconductor.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-08-02 13:30:45 +0900
Author date: 2013-08-02 13:30:45 +0900
Commit id: 0d29dcd812655bb18f6da99b83ea457e394895e5
Unified the syntax of common_clonotypes and unique_clonotypes.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-08-01 11:22:19 +0900
Author date: 2013-08-01 11:22:19 +0900
Commit id: bff994b1f14ab6665eedc15598df5e83ae8254b0
Resubmitted clonotypeR_0.99.5.tar.gz to Bioconductor.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-05-07 21:28:42 +0900
Author date: 2013-05-07 21:28:42 +0900
Commit id: 215825af72dc8d3369b1e9dad056673ca2fcada1
Add vignette to html_doc; refresh.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-05-07 21:14:47 +0900
Author date: 2013-05-07 21:14:47 +0900
Commit id: fbfe17c884da59b2a3bbab07575971eb588bd12e
Rework vignette to use additional example data.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-05-07 21:08:06 +0900
Author date: 2013-05-07 21:08:06 +0900
Commit id: 6e3d48de97f5df855917fc55ed06ff7f315ee3a1
Clonotypes extracted from example_data.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-05-07 20:51:18 +0900
Author date: 2013-05-07 20:51:18 +0900
Commit id: 8de1988b83f118767b0abfabb988ad769a7dcabf
Corrected a typo.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-05-07 11:41:02 +0000
Author date: 2013-05-07 11:41:02 +0000
Commit id: f1a95ffc338cc9628aa043f8a2319efe33caec09
No time today.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-05-07 11:38:20 +0000
Author date: 2013-05-07 11:38:20 +0000
Commit id: 815fbcbae66770f01649bd9c7e65f90569240b4f
Added executable example with test data to the vignette.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-05-01 21:55:33 +0900
Author date: 2013-05-01 21:54:32 +0900
Commit id: 5e658adbd8fb8a2b34511f2f0e9db94335145b0e
Moved vignettes to root for automatic building.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-05-01 21:52:46 +0900
Author date: 2013-05-01 21:52:46 +0900
Commit id: 963544b03c57819095ba459d46ebed561d9762d0
Resubmitted 0.99.3 to Bioconductor.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-26 13:29:56 +0900
Author date: 2013-04-26 13:29:56 +0900
Commit id: 21de5ed25d5afb0bb7e5c9cab6b3105e98a99f52
Refreshed documentation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-26 13:25:26 +0900
Author date: 2013-04-26 13:25:26 +0900
Commit id: 287c9829612cd1a0407b9d15178ad5548fc50396
Describe the extra data in a common manual page.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-26 13:24:15 +0900
Author date: 2013-04-26 13:24:15 +0900
Commit id: b5e5bc8c46e47174722c054b419360a9a256b30a
Correct source code and documentation after moving data to 'inst/extdata'.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-26 12:46:41 +0900
Author date: 2013-04-26 10:40:12 +0900
Commit id: dfe97762cf7c1e827de216bbcbf056bbfeacd4f3
Moved data to 'extdata' as it is not in the '.Rd' format.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-26 10:34:58 +0900
Author date: 2013-04-26 10:34:58 +0900
Commit id: 6e27d1f7f50aa721240da77a763b09e64fe1e8ef
Renamed 'doc' director to 'vignettes' to enable auto-building of the knittr vignette.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-26 10:30:56 +0900
Author date: 2013-04-26 10:30:56 +0900
Commit id: 14f4c3a0fd67591d930df4a550cf9ea25fa8cc53
Refreshed documentation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-18 09:22:59 +0900
Author date: 2013-04-18 09:22:59 +0900
Commit id: f84db0e8fdcb1a6c03b81c4230c2b8b5c9504a26
0.99.2
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 21:56:30 +0900
Author date: 2013-04-15 21:56:30 +0900
Commit id: 7cf966e77891afcb2d85aa25600cd07c661df9ec
Declare methods.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 21:54:25 +0900
Author date: 2013-04-15 21:54:25 +0900
Commit id: 87ab884780b23897a64a17679b23de4271ed65c0
Declare encoding.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 21:54:14 +0900
Author date: 2013-04-15 21:54:14 +0900
Commit id: 022bebfd23ea34b53cd0c66144481296e0e6832b
Point to license file instead of using unknown keyword (CC0).
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 21:30:48 +0900
Author date: 2013-04-15 21:30:48 +0900
Commit id: c6def55b5a3b83452d39323ef8747de9d065a230
Mention that the V and J data can be changed.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 21:30:17 +0900
Author date: 2013-04-15 21:30:17 +0900
Commit id: 54772072fccb68a5f775c3d0091c6ce6abff20fa
Mention that the data is from mouse.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 21:28:43 +0900
Author date: 2013-04-15 21:28:43 +0900
Commit id: 696cb2bc3af330f78f025ffb8092d9f5c2c78427
yassai_identifier: correct multiple output bug when input is a single clonotype.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 21:15:12 +0900
Author date: 2013-04-15 21:15:12 +0900
Commit id: edd71c4cce53992e8adc97afa27acb59c42267df
Call S4 methods only.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 20:33:28 +0900
Author date: 2013-04-15 20:33:28 +0900
Commit id: c0118e3fc2c9f472bab223dd30b31f5fee3e8468
yassai_identifier: load codon_ids as characters.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 20:22:17 +0900
Author date: 2013-04-15 20:22:17 +0900
Commit id: 5bddce379f902d859e3a7667a8386786c91e5e47
Load data from within function; remove un-necessary checks.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 20:01:00 +0900
Author date: 2013-04-15 20:01:00 +0900
Commit id: 7722f3669a425ee6cc78257437479353e7609479
Use a S4 method to facilitate the change or reference sequences.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 19:15:00 +0900
Author date: 2013-04-15 19:15:00 +0900
Commit id: b4aa7dbfadcc4c5179ff513a8acbc37e2c01032a
Replace DOI by PMID.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 16:32:17 +0900
Author date: 2013-04-15 16:32:17 +0900
Commit id: cd259b4799e155c52039a17bf3d0b4cc25ea8f93
Mention Decombinator.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 16:30:25 +0900
Author date: 2013-04-15 16:30:25 +0900
Commit id: 4e780a457c5b8f522a61cea1f4309de109d30c72
Mention that only mouse is supported currently.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 14:43:09 +0900
Author date: 2013-04-15 14:43:09 +0900
Commit id: c7e4dcbd016e84a0b8be69243a054e1655053c91
Correct confusion between human and mouse.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 14:22:16 +0900
Author date: 2013-04-15 14:22:16 +0900
Commit id: e064fc66e7bac6a8c98b59b45e519a660539fca4
Link to RefSeq's TCR loci for Human.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 14:07:41 +0900
Author date: 2013-04-15 14:07:41 +0900
Commit id: a3b6ea1cac7c3fbeb4366f169cde34722c3e0b94
Delete old PDF vignette.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 13:45:49 +0900
Author date: 2013-04-15 13:45:49 +0900
Commit id: 5781783e0dd3868e503c7ee3d98188607fc843c2
Do not build a PDF vignette.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 13:45:33 +0900
Author date: 2013-04-15 13:45:33 +0900
Commit id: b9d0aa92434f360b3f23e8eb05c0da65c90d2ea5
Refreshed PDF vignette.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 13:29:35 +0900
Author date: 2013-04-15 13:29:35 +0900
Commit id: 906aadcd4932fe78b48a539d7aebeb8d33922283
Update date.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 13:28:45 +0900
Author date: 2013-04-15 13:28:45 +0900
Commit id: 8c423487f471c52a3b6ec21a232ec7d23b097bbb
Adjust whitespace.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 13:26:51 +0900
Author date: 2013-04-15 13:26:51 +0900
Commit id: d7457f354d8bc9b8e0b945ef8eb289236aafb004
Use knitr::knitr as in the R-exts manual.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 13:23:40 +0900
Author date: 2013-04-15 13:23:40 +0900
Commit id: 8fe447b31ba96d887d5fbd7c6e48dc7f717505a1
Correct whitespace.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 13:18:36 +0900
Author date: 2013-04-15 13:18:36 +0900
Commit id: e3671747c8ed17e5365e3b26b26d894fe1541dc6
Minor change of the auto-generated documentation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 13:13:27 +0900
Author date: 2013-04-15 13:13:27 +0900
Commit id: 7518dec2320343ae89a82ae05d0ed109eb87d1df
Build vignette with Knitr.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 13:12:08 +0900
Author date: 2013-04-15 13:12:08 +0900
Commit id: 3934ced36d088184ccca45de2871e82b8cbf5589
Vignette inspired from doc/examples/with_test_data.mdwn.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 11:38:05 +0900
Author date: 2013-04-15 11:38:05 +0900
Commit id: d0d8ff9cdea8a21b07a63fcba84b833689bf65d1
Use a syntax similar to the Markdown vignette.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 11:36:45 +0900
Author date: 2013-04-15 11:36:45 +0900
Commit id: 67a7959b669482499a9cac1b06dad42d864cbc05
Removed spurius line.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 11:23:49 +0900
Author date: 2013-04-15 11:23:49 +0900
Commit id: 1490559fb26a4f2e34042177b1bc5e025972bfe2
Build vignette with knitr.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 10:25:44 +0900
Author date: 2013-04-15 10:25:44 +0900
Commit id: ad181fefec0beea6628cae73c8d8ed0b166c0783
Preparing conversion to Markdown format.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 10:22:29 +0900
Author date: 2013-04-15 10:22:29 +0900
Commit id: 268c48c41d9fdb654d440134a705e4c1ddf85c78
Update affiliations.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-12 09:29:43 +0900
Author date: 2013-04-12 09:29:43 +0900
Commit id: 5f13c20bcc6616c64a6e17c0c37ce1e7cf8e6ce1
Mention the CLST.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-11 09:55:58 +0900
Author date: 2013-04-11 09:55:58 +0900
Commit id: 6daa7dc64bb4b527677048fa61249238e300ad1b
Mention the OSC as recipient of the MEXT grant.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-08 14:56:02 +0900
Author date: 2013-04-08 14:56:02 +0900
Commit id: 05c8fc7b9777cf498da5d1e9e413e35681ab08f0
Mention acknowledgement and license in README.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-08 13:44:56 +0900
Author date: 2013-04-08 13:44:56 +0900
Commit id: c0434a694d7371a69d7665e28c2649f1432bc209
Refreshed HTML documentation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-02-27 14:35:05 +0900
Author date: 2013-02-27 14:35:05 +0900
Commit id: c69abf1c31fb192496dfbe2b254e782afea5d8e8
clonotypes.txt.gz: moved from data to inst/extdata.
It has to ble loaded through read_clonotypes.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-02-27 13:58:47 +0900
Author date: 2013-02-27 13:58:47 +0900
Commit id: d81ac599776ecbf97d498537bf064532942d9168
Recompressed the data files.
This makes the source repository similar to the binary package.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-02-27 13:38:14 +0900
Author date: 2013-02-27 13:21:33 +0900
Commit id: 388c8e69dab3642f11cee5349c6a8019819b7a80
yassai_identifier: disambiguate 'head' to 'header'.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-02-27 11:21:10 +0900
Author date: 2013-02-27 11:21:10 +0900
Commit id: e3faba5989703e85f6613385b677c3b553a30799
yassai_identifier: removed duplicated output in the manual page.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-02-27 11:18:44 +0900
Author date: 2013-02-27 11:18:44 +0900
Commit id: 282637e882f92b733b3bf6f155f904fe5702a352
Systematically load accessory data; convert factors to characters.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-02-26 19:51:05 +0900
Author date: 2013-02-26 19:51:05 +0900
Commit id: 59b6461d172c6d58345c98defb2456e1fac7debb
Uncompressed the data files.
(Some were actually not compressed).
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-02-26 19:04:47 +0900
Author date: 2013-02-26 18:36:36 +0900
Commit id: c9130ebc1a6e53015c8f342d9bd381e03f4feba8
Deleted 'dontrun' instruction.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-02-26 19:04:47 +0900
Author date: 2013-02-26 18:35:38 +0900
Commit id: b8ee044d9034900cc686ac2d4a7ec8117f0cd47c
Replaced '.' by '_' in function names to avoid confusion with S3 dispatches.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-02-26 19:04:47 +0900
Author date: 2013-02-26 17:06:30 +0900
Commit id: 0d6cb9aca3774b97e615428e34c0f3a6006dba46
Renamed functions to replace '.' by '_' and avoid confusion with S3 dispatches.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-02-26 19:04:47 +0900
Author date: 2013-02-26 16:59:55 +0900
Commit id: 7e22515d9e8676aaff8a9bd98fa062b8106829be
Renamed ChangeLog to NEWS.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-02-26 19:04:47 +0900
Author date: 2013-02-26 16:51:46 +0900
Commit id: fe8d8f98117e578ac5342b54edb9a7533f6865cb
Ensured entries are regular expressions.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-02-26 19:04:47 +0900
Author date: 2013-02-26 16:50:08 +0900
Commit id: a080dd9bb390c0c11fef3c4288f4d05f7cc35671
Corrected a typo.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-02-26 19:04:47 +0900
Author date: 2013-01-31 17:57:46 +0900
Commit id: c89cd64950677f13a7c0e9ff4fd3e678ecde279b
Moved installation instructions in a separate page.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-31 15:52:19 +0900
Author date: 2013-01-31 15:52:19 +0900
Commit id: 1a6fcf9f4afa20602333d73386ba3df1c16cd8af
Ignore markdown pages and stylesheets.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-31 15:33:37 +0900
Author date: 2013-01-31 15:33:37 +0900
Commit id: 85f09c908e98fc82135402f8f18b77201625fc46
Merged READMEs.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-31 15:32:28 +0900
Author date: 2013-01-31 15:32:28 +0900
Commit id: c276efdec658cd390cf95e51d1dad9408b5070b3
Symbolic link for ikiwiki only.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-31 15:06:56 +0900
Author date: 2013-01-31 15:06:56 +0900
Commit id: 43b020942234862c7faf6aa9fe2773280dccc97d
Renamed README to comply with Bioconductor.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-31 15:05:23 +0900
Author date: 2013-01-31 15:05:23 +0900
Commit id: 0e945d7a1751661908b94553e537ec30fbd0ccc8
Normalised parameters, using "data=", like in many other R functions.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-31 15:03:40 +0900
Author date: 2013-01-31 15:03:40 +0900
Commit id: e323ec8cd505b1ca9057810a1e9ec656c432d261
Replaced unidentified white character by ASCII space.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-31 14:57:53 +0900
Author date: 2013-01-31 14:57:53 +0900
Commit id: 41d662541c2ab7734f6cee248db723613c65ae98
Do not chose the object called 'clonotypes' by default.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-31 14:57:05 +0900
Author date: 2013-01-31 14:49:11 +0900
Commit id: 10e8717eb6c81c331a2381b93c2a3fe8537de4e9
Merge branch 'master' of git+ssh://osc-lm/osc-fs_home/plessy/git/R/clonotypeR
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 20:38:26 +0900
Author date: 2013-01-08 20:38:26 +0900
Commit id: 48c9fa1f8ab9a7457c7b579c41bded434cd14325
Mention http://clonotyper.branchable.com/
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 20:16:27 +0900
Author date: 2013-01-08 20:16:27 +0900
Commit id: 74925abe92ed7682b56afeb749242aff027def2c
Comment on why the version number starts at 0.99.1.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 20:04:24 +0900
Author date: 2013-01-08 20:04:24 +0900
Commit id: 5fbd8273a36f679032ea615c35b10ecc298aec85
Added biocViews.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 20:00:42 +0900
Author date: 2013-01-08 20:00:42 +0900
Commit id: f304198cf85e7b0546dc4defb68746d03ded0991
Removed file that looks commited by accident.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 19:52:51 +0900
Author date: 2013-01-08 19:52:51 +0900
Commit id: 948e022dcc62643c99a41691e75485dfbca96ae0
Corrected argument name that was too short.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 19:51:51 +0900
Author date: 2013-01-08 19:47:09 +0900
Commit id: 06d1e32a7b6e0fd8bebbc109c9c3caa508599ec0
Notes for the review in Bioconductor.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 19:51:50 +0900
Author date: 2013-01-08 19:43:32 +0900
Commit id: 37298f964077bd147e58052dcf379ff0e5ba73b0
Systematically convert as character, because it is not expensive.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 15:38:30 +0900
Author date: 2012-12-20 21:14:34 +0100
Commit id: dac237885150db368a81e979959011f6f440bfef
Corrected capitalisation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 15:38:30 +0900
Author date: 2012-12-20 11:12:16 +0100
Commit id: 88802f5697838f99b84d74d69617428285d42d68
Also ignore the makefile.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 15:31:20 +0900
Author date: 2013-01-08 15:31:20 +0900
Commit id: d466ad34a6918d42f9fb04c836fd9a6e2dbc2a5b
Explanations about the full source being at git://clonotyper.branchable.com/.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 15:25:06 +0900
Author date: 2013-01-08 15:18:03 +0900
Commit id: 898e169b28fddc6d6fd82536849d18473d58761b
Remove more directories from the Bioconductor package.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 15:25:05 +0900
Author date: 2013-01-08 15:12:21 +0900
Commit id: e93ddb3b48e86a7cdf4353a01ab1721e5bf06dd9
Leaner Bioconductor package, without the wiki documentation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 14:37:36 +0900
Author date: 2013-01-08 14:37:36 +0900
Commit id: 0c2e008f00ee7f7b5e2e1c652fba18c7f00c0ece
Separate .gitignore and .Rbuildignore, to make the Bioconductor package leaner.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 14:34:28 +0900
Author date: 2013-01-08 14:34:28 +0900
Commit id: 45ed4234f5aa4569d871e7320ac310da66285608
Changes forgotten on RIKEN's computer at the end of December.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 14:26:38 +0900
Author date: 2013-01-08 14:26:38 +0900
Commit id: 5edd776656a5f465f834e6ac214a61cc02bf6ee2
Version 0.99.0 according to Bioconductor's guidelines.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-12-16 14:32:05 +0100
Author date: 2012-12-16 14:32:05 +0100
Commit id: 13df713cc992a4882d2e5980d8a39848c7a1039e
Added a one-page vignette pointing at the website.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-12-16 14:26:28 +0100
Author date: 2012-12-16 14:21:21 +0100
Commit id: 5ab860942ffe79aba6baca2b913b4ad6625c7dc1
Removed the function zzz.R supposed to preload support data for yassai.identifier().
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-12-16 12:07:50 +0100
Author date: 2012-12-16 12:07:50 +0100
Commit id: 436a2e1042b9e9ca73abd1fe7d7c24e0ebaf413d
Corrected syntax error in a stop() command.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-12-15 17:23:36 +0100
Author date: 2012-12-15 17:23:36 +0100
Commit id: 9f12d2674c9487be789031053c8a0b0e9b26beeb
Delete accidentally committed swap file.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-12-15 17:10:45 +0100
Author date: 2012-12-15 17:10:45 +0100
Commit id: 3f6bfeae88b74151549842a8c1ae9dc2ef8ea318
Conversion from SRA format (NCBI)
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-12-05 10:23:44 +0000
Author date: 2012-12-05 10:23:44 +0000
Commit id: 7e2b740f7d04e8d104922e3a236b54c3528d4e1e
Replaced another occurence of "Improductive".
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-11-15 23:07:33 +0900
Author date: 2012-11-15 23:07:33 +0900
Commit id: 51de60575e84883082d0b5e148f805d37eae84de
clonotype.table: do not require the presence of score and mapq columns.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-11-15 21:27:02 +0900
Author date: 2012-11-15 21:27:02 +0900
Commit id: fae965441114dca1419418a64c98ea3354c840a4
read.clonotypes: added a scores argument to load legacy data.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-11-15 21:16:59 +0900
Author date: 2012-11-15 21:16:59 +0900
Commit id: 5686598591cfdf104e69930ef06220290f3dbaf0
Renamed yassai.nomenclature yassai.identifier.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-11-14 15:21:30 +0900
Author date: 2012-11-14 15:21:30 +0900
Commit id: ae5da6c7620ffa7058099e44aec177d2be5f2126
yassai.nomenclature: convert vector to data frame and check presence of appropriate names.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-11-14 15:08:50 +0900
Author date: 2012-11-14 15:08:50 +0900
Commit id: 16778f15548db144b84f1d4bb99fccfd2d6650b0
yassai.nomenclature: change default data and parameter name.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-11-14 15:04:54 +0900
Author date: 2012-11-14 15:04:54 +0900
Commit id: 9ebffb23af76ad68628f8ce04737c6bc9ff03980
is_unproductive: new function taken out from read.clonotypes.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-11-14 11:14:03 +0900
Author date: 2012-11-14 11:01:15 +0900
Commit id: a8745080db4508670e2202f1df9e7a57269b6fbc
R script to ensure a proper class for the columns of the clonotypes data frame.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-11-14 10:32:11 +0900
Author date: 2012-11-14 10:32:11 +0900
Commit id: 663089c363eeb2dc6f5ad1ce2906308adb157ee2
rename doc/examples/with__95__test__95__data.mdwn to doc/examples/with_test_data.mdwn
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-11-05 09:58:20 +0000
Author date: 2012-11-05 09:58:20 +0000
Commit id: d40f85b6e358ddb8a827434445d621298314bcae
update for rename of doc/example.mdwn to doc/examples/with__95__test__95__data.mdwn
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-11-05 09:57:25 +0000
Author date: 2012-11-05 09:57:25 +0000
Commit id: ca7e604f9383280b3c7747cba6a61f4156baf51b
rename doc/example.mdwn to doc/examples/with__95__test__95__data.mdwn
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-11-05 09:57:25 +0000
Author date: 2012-11-05 09:57:25 +0000
Commit id: 969aabaf80be8309c49016b20de23818a4594b49
Add a link to the tips.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-11-05 09:05:26 +0000
Author date: 2012-11-05 09:05:26 +0000
Commit id: e3596fde1a53d33d2a918d27a8814e9b7f53645a
Homogenize typography.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-10-10 20:48:36 +0900
Author date: 2012-10-10 20:48:36 +0900
Commit id: 44b92e4fce8bd95671ad4ecf30be21ea0bebc4cf
Link to J_before_FGxG and V_after_C.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-10-10 20:47:07 +0900
Author date: 2012-10-10 20:47:07 +0900
Commit id: a3e8745ba39a0732979afbea7ea0876f16b4e98b
Documented V_after_C and J_before_FGxG.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-10-10 20:44:22 +0900
Author date: 2012-10-10 20:44:22 +0900
Commit id: 6f1ce7e778394062e3f9f5d684bec298fd2b4559
Added an alias for the codon_ids table.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-10-10 20:32:16 +0900
Author date: 2012-10-10 20:32:16 +0900
Commit id: 80a15c8ef6de3a12bd9fd2a978ec74ddc901bc0a
Refreshed HTML documentation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-10-10 20:27:18 +0900
Author date: 2012-10-10 20:27:18 +0900
Commit id: 5e875c51623030840d62a7126c604601a9c1bc18
Renamed html html_doc to avoid a warning.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-10-10 20:00:28 +0900
Author date: 2012-10-10 19:56:56 +0900
Commit id: 3b7f393ee667f93a047558ed9301012beb0d0393
Exclude multi-megabyte example data from the R package.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-10-10 19:38:40 +0900
Author date: 2012-10-10 19:38:40 +0900
Commit id: 4617fab37a16d1a3ed4154b866515d3b5a760616
Added a changelog (GNU-style).
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-10-10 18:56:30 +0900
Author date: 2012-10-10 18:56:30 +0900
Commit id: 702bfc4f59e331c3c9fa797d196dfc969870e856
Corrected Frenglish “improductive” with “unproductive”.
This can break backwards compatibility.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-10-10 18:55:11 +0900
Author date: 2012-10-10 18:55:11 +0900
Commit id: 284902d16b5c040f0d56577642a851b7c408976c
Corrected typo.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-10-10 18:49:15 +0900
Author date: 2012-10-10 18:25:58 +0900
Commit id: 322a12f4bd1a583fa72984439120c2a8d97dcf63
Tip: Reverse-complement and append mate-pair sequence to the first read
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-10-09 11:35:00 +0000
Author date: 2012-10-09 11:35:00 +0000
Commit id: a02891f1fef7e36843b8b049b6d4616b65446302
To do: Report the number of V segments found after `clonotypeR detect`.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-10-09 11:22:11 +0000
Author date: 2012-10-09 11:22:11 +0000
Commit id: f2dcc5971b58d68b95d3279ca70be81c8064c903
Link to source archive in the git repository (branch « release »).
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-09-06 10:38:39 +0000
Author date: 2012-09-06 10:38:39 +0000
Commit id: 06f61655c82aa5261a82c6645d81fde5322904f7
Changed version number (R requires integers), and corrected installation instructions.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-09-06 19:25:48 +0900
Author date: 2012-09-06 19:25:48 +0900
Commit id: a180ec1a79acf71f837dba43e07750e0512d9315
Current version at the time of first submission.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-09-06 19:14:21 +0900
Author date: 2012-09-06 19:14:21 +0900
Commit id: c178971ed2687a8aab4151bbbd79fad0d25551d5
Link to gallery with thumbnails.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-09-06 06:51:35 +0000
Author date: 2012-09-06 06:51:35 +0000
Commit id: fb339a75a2760ddcce0606e5a969a44958260f53
Gallery page.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-09-06 06:45:32 +0000
Author date: 2012-09-06 06:45:32 +0000
Commit id: 48316a2d65dac58420c2240c5e0730933d1fabb4
Corrected name.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-09-06 15:28:43 +0900
Author date: 2012-09-06 15:28:43 +0900
Commit id: e22135b6dc898713766d7881091cffed2a3c7e7b
Thumbnails
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-09-06 15:27:53 +0900
Author date: 2012-09-06 15:27:53 +0900
Commit id: ba6bbfd3b766c4528dc2479e7f415fd07a27c2b7
Example output files from R.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-09-06 15:18:22 +0900
Author date: 2012-09-06 15:18:22 +0900
Commit id: df014b0aed6b1c424c10c1fc441da346ad27edd8
Installation from source.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-09-06 05:45:59 +0000
Author date: 2012-09-06 05:45:59 +0000
Commit id: 0a192aff326956d64578ad40d33fd68cfa4ae2e5
Indicate the name of the unknown libaries.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-09-04 14:36:24 +0900
Author date: 2012-09-04 14:36:24 +0900
Commit id: 5926af361e73ace48ac790e2ff75f6102e54d347
3,653 V–J pairs were detected in SRR407172.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-11 10:44:02 +0000
Author date: 2012-08-11 10:44:02 +0000
Commit id: 9d0226640e2a930a0bc7fb0100cced0837b8c8a8
Suggest pvclust.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-11 17:38:32 +0900
Author date: 2012-08-11 17:38:32 +0900
Commit id: 931fc14f0f83dc5de39a86b7e791032bb324a213
Filter out reads with low mapping quality and alignment scores.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-10 22:13:27 +0900
Author date: 2012-08-10 22:12:13 +0900
Commit id: 6158d7b93dc57d6edd3390c9977a6409ecf510b8
Removed mention of clonotyper convert.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-10 03:50:37 +0000
Author date: 2012-08-10 03:50:37 +0000
Commit id: 464080b5d6c02cdd7c0acd28b9f102ebaf1cd473
Work in /home/ubuntu/clonotyper.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-10 03:50:01 +0000
Author date: 2012-08-10 03:50:01 +0000
Commit id: 6263579ee80b80442b6f5ca0bd3a271489fdb572
Link to /mnt, and added a warning.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-10 03:48:33 +0000
Author date: 2012-08-10 03:48:33 +0000
Commit id: 30ef03fd9863082955e0a5d4bd0753626f3e5c23
Document score and mapq columns.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-10 09:54:06 +0900
Author date: 2012-08-10 09:53:34 +0900
Commit id: 1f461943a713cfa8f9a8b8095a14fb6545c1664d
Users not in the group staff need administrator priviledges.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-09 22:46:44 +0000
Author date: 2012-08-09 22:46:44 +0000
Commit id: 563284305b499452309164cfc0c46ab92eb9ce52
Do not load sequences as factors.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-09 14:54:59 +0900
Author date: 2012-08-09 14:54:59 +0900
Commit id: c4e488154eec177bfa037581369aa95b3325ff7e
Merge branch 'master' of ssh://clonotyper.branchable.com
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-09 14:08:24 +0900
Author date: 2012-08-09 14:08:24 +0900
Commit id: 159b21792b0845462cb13e47e7a0f79364cad990
Suggest vegan.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-09 14:04:47 +0900
Author date: 2012-08-09 14:04:47 +0900
Commit id: d3b4a62dd7cf418ac93f364ca82f6b2dd759a9cf
No need for pandoc in this example. Do not note twice that instance storage is mounted in /mnt. Remove timestamps.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-09 05:04:12 +0000
Author date: 2012-08-09 05:04:12 +0000
Commit id: 4c51296f717e3fa201eb3da71ff61e455d81ad33
Merge branch 'master' of ssh://clonotyper.branchable.com
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-09 13:44:06 +0900
Author date: 2012-08-09 13:44:06 +0900
Commit id: 9727ed496024a33f0851f2a9a8211b53b2f4d1ae
How to build and install the clonotypeR R package from the Git clone.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-09 04:44:46 +0000
Author date: 2012-08-09 04:44:46 +0000
Commit id: 2514e4d01f4326fcf1bf70d3a5161774deb19e7b
Compress the segment sequence files.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-09 13:26:34 +0900
Author date: 2012-08-09 13:26:34 +0900
Commit id: 21ae3c1ccc3f0f51e199a38aea7ea664858d58a8
Segment data for R, and mechanism to refresh it. This needs Bioconducor's Biostrings package.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-09 13:19:41 +0900
Author date: 2012-08-09 13:19:41 +0900
Commit id: 53004ed4a20f35b0859e83483ceefd515de8e6c8
module → package.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-09 13:08:10 +0900
Author date: 2012-08-09 13:08:10 +0900
Commit id: 960b90f5e5a37a62b0da374d39c39410c6d23d2b
Change the mechanism that provides segment data in R, to avoid run-time dependance on Biostrings.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-09 13:02:27 +0900
Author date: 2012-08-09 11:43:55 +0900
Commit id: 3158e88845e3a8b87e75d865e35cd9eb8098974f
Build the R module of *clonotypeR*.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-09 00:10:35 +0000
Author date: 2012-08-09 00:10:35 +0000
Commit id: 32af088c165b4b4c009d7098792b82b998d526c8
Link to instructions to convert FASTQ files, outline of analysis in R.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-08 08:53:03 +0000
Author date: 2012-08-08 08:53:03 +0000
Commit id: 4cdc78d3d250a5427b834fbb6f74ff1b23376ea9
Download and use sff_extract to convert the 454 SFF files.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-08 08:50:09 +0000
Author date: 2012-08-08 08:50:09 +0000
Commit id: ca6915ec03752d8a90f3f6ee296161b62d37225d
sff_extract is now recommended but not required.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-08 08:48:26 +0000
Author date: 2012-08-08 08:48:26 +0000
Commit id: 5950e562b5ce019b71b0b8a6d6901a342567a6ce
How to convert many AB1 files in a single FASTQ file.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-08 07:51:36 +0000
Author date: 2012-08-08 07:51:36 +0000
Commit id: 457214be1be8133574ab98cd362464ed161e5c19
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-08 07:47:12 +0000
Author date: 2012-08-08 07:47:12 +0000
Commit id: d4c17bf9c5f0c90206bc8232f4d3adc99f787f9d
Postpone development of conversion command.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-08 16:03:28 +0900
Author date: 2012-08-08 16:03:28 +0900
Commit id: 27764d3d29a491a2052aa1f195ab714fffca3baf
Merge branch 'master' of ssh://clonotyper.branchable.com
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-08 16:00:50 +0900
Author date: 2012-08-08 16:00:50 +0900
Commit id: 21337966a854f79522db90c29132ef69591481d4
Update manpage.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-08 07:01:31 +0000
Author date: 2012-08-08 07:01:31 +0000
Commit id: e592ed9f63e8047d1a229f7bf98c336556062c70
Remove double quotes, to allow processing more than one file (with no spaces in the name).
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-08 15:57:41 +0900
Author date: 2012-08-08 15:57:41 +0900
Commit id: 7127f9a60d238c7d9d6f30d0ac1b2e7a7f7be958
Postponed the development of a conversion command.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-08 06:49:15 +0000
Author date: 2012-08-08 06:49:15 +0000
Commit id: 92c5e1ecab616956085d515371d9df9ccf80c031
Give up parsing single clonotypes for the moment, and update documentation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-08 15:17:46 +0900
Author date: 2012-08-08 15:17:46 +0900
Commit id: 55819b5e99a2c2a871542295012e1e977caf945a
Updated example to contain alignment scores and mapping qualities.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-08 15:05:07 +0900
Author date: 2012-08-08 15:05:07 +0900
Commit id: 4665683767030eaf441918a0297c9ffd71cb0569
Use standard names for segments that has a counterpart that was removed.
For instance, TRAV7N-5_7D-5 is reverted to TRAV7N-5.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-08 14:52:26 +0900
Author date: 2012-08-08 14:52:26 +0900
Commit id: fe58ce50dd0f301e55d89714e7bb10c9c14cc56b
Convert to character if necessary.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-08 07:42:22 +0900
Author date: 2012-08-08 07:42:22 +0900
Commit id: 2bc1420b180a897dc45d69feff4a1a714f2e3890
Done in commit 7cf11805d84ff8dc6a537c17e73efa275077915d.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-07 11:14:39 +0000
Author date: 2012-08-07 11:14:39 +0000
Commit id: 943dbeb9c433a9d0857e440934ebad63131bfcc3
Created a shortcut for commits.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-07 11:13:20 +0000
Author date: 2012-08-07 11:13:20 +0000
Commit id: b4fb181e9402fadbe60e33064b213996f887ab34
Documentation updates.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-07 20:00:01 +0900
Author date: 2012-08-07 20:00:01 +0900
Commit id: cd8789b3b1ca5eb8b0ff9ca74b873632c834f45a
Accept alignment scores and mapping qualities.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-07 19:53:21 +0900
Author date: 2012-08-07 19:53:21 +0900
Commit id: 3b762f51300af2e5760630f35d01e3842242048d
Corrected and vectorised yassai.nomenclature.R.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-07 19:39:10 +0900
Author date: 2012-08-07 19:39:10 +0900
Commit id: 7cf11805d84ff8dc6a537c17e73efa275077915d
Convert names of V and J segments in yassai.nomenclature().
Closes: 87de09572d8ed59646625d2929b88bce1a3f691b
Closes: yassai.nomenclature_returns_incorrect_values.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-06 21:16:22 +0900
Author date: 2012-08-06 21:16:22 +0900
Commit id: 7484c392a39c5a13e23274dad6c778fbc59ea6d1
Replace hardcoded column names by their name.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-06 21:07:05 +0900
Author date: 2012-08-06 21:06:47 +0900
Commit id: 5b5498fd65be98f69e3954a20a78cbdbd5081d2e
Extract and detect clonotypes from GSE35626.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-05 03:11:40 +0000
Author date: 2012-08-05 03:11:40 +0000
Commit id: 219d9df718d33a5b28b92e43aae5655312931411
Instructions to run from git clone will be completed later.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-05 03:06:29 +0000
Author date: 2012-08-05 03:06:29 +0000
Commit id: 2d724f12fda97d167bb5894d3c783d5d64dfb606
Added back pseudogenes, polished alignment, rebuilt derived files.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-05 12:05:14 +0900
Author date: 2012-08-05 12:04:16 +0900
Commit id: 7e84f7c766a4eb429a9e731cbe89198a50925d40
Added back TRAV6D-6 and TRAV6N-6 as they are unique, explain about removals.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-05 12:05:14 +0900
Author date: 2012-08-05 09:32:45 +0900
Commit id: cb88320627458f0e54be47dbd80dfec20ad91754
Install clonotyper from source in /mnt.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-04 23:49:26 +0000
Author date: 2012-08-04 23:49:26 +0000
Commit id: 84a978afa19dcdaee718474e5384988b5d0f21be
Inserted a table of contents.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-04 13:09:17 +0000
Author date: 2012-08-04 13:09:17 +0000
Commit id: 46312bacdbebe13f8ef9e73fec5066a08f42bb8b
Convert from SRA to FASTQ format with the SRA Toolkit.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-04 13:06:56 +0000
Author date: 2012-08-04 13:06:56 +0000
Commit id: d775e894f2447be67b010d3fe3691d7e988afd8e
Record all mapping qualities and alignment scores instead of discarding low ones.
The scores are temporarly embedded in the read names. The filtering will take
place in R with the function "clonotype.table".
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-04 21:54:36 +0900
Author date: 2012-08-04 21:54:36 +0900
Commit id: 6ee0d196cac21307a36bdf41c896cb33d2d62b9e
Pass CLONOTYPER_REFERENCE to VJsplit.
VJsplit and clonotypeR should rather be merged.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-04 21:51:10 +0900
Author date: 2012-08-04 21:51:10 +0900
Commit id: c6967a6fdea7d9f270fd3814a407ffa0f727478f
Do not set CLONOTYPER_REFERENCE in VJsplit if absent.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-04 21:50:39 +0900
Author date: 2012-08-04 20:51:26 +0900
Commit id: 49370c4b6ef91b1397c7ab0b9701965ea6ef33dd
Really count the number of V segments detected.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-04 12:07:17 +0000
Author date: 2012-08-04 12:07:17 +0000
Commit id: 30a6c55210e2c095adb32337064e4aebd601bf8b
Look for scripts and reference alignments in fixed locations where no path is provided.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-04 20:48:49 +0900
Author date: 2012-08-04 20:48:49 +0900
Commit id: cdb630e18dfa3c9edef57f9205773c00a1235366
create a directory for analysis in /mnt, where the instance storage is mounted.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-04 11:46:17 +0000
Author date: 2012-08-04 11:46:17 +0000
Commit id: 7f5722071879eedf1427bcf3d7145ff8c58debb9
Startyed example analysis using the GSE35626 public dataset.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-04 09:35:55 +0000
Author date: 2012-08-04 09:35:55 +0000
Commit id: 659686f92e6b0b22ea3fb9188ae8da67f752b6b4
Example analysis using the GSE35626 public dataset.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-04 09:18:17 +0000
Author date: 2012-08-04 09:18:17 +0000
Commit id: 0ac53483220ff1153b67e6d1a2aa3e2ced726384
Link to the example with the GSE35626 dataset.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-04 09:15:57 +0000
Author date: 2012-08-04 09:15:57 +0000
Commit id: f2a41806b5e2f25113b788508d2c3b8a37909a3c
Document what common_clonotypes does on a single group of samples.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-03 18:18:54 +0900
Author date: 2012-08-03 18:18:54 +0900
Commit id: 32f81615ac4de2c7240c2f7058d3a8689845343d
Typo.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-03 15:34:00 +0900
Author date: 2012-08-03 15:34:00 +0900
Commit id: 8e4caeb05e7a4a628c21c6b9338528c68fdea50a
Refreshed R documentation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-03 15:27:31 +0900
Author date: 2012-08-03 15:27:31 +0900
Commit id: ccbeb8f84a147c49e883d83b93e7c2293585ac5f
Example on how to count clonotypes common to two groups of libraries.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-03 15:26:41 +0900
Author date: 2012-08-03 15:26:41 +0900
Commit id: deec7882c6975b93c6f3bc663031e2c60f8a3dd5
Use all libraries of the clonotypes data frame by default.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-02 11:02:39 +0900
Author date: 2012-08-02 11:02:39 +0900
Commit id: 4ce04656c3321fa05d1956ff484d85ea3259d2af
Specify the field separator.
This allows empty 'peptide' values, when the CDR3 is shorter than 3 bases.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-01 16:06:31 +0900
Author date: 2012-08-01 16:06:31 +0900
Commit id: 2253562b4dd5303c5da536c1bd29c0653e8fdb79
Skip header only for OSCTable files (TSV files do not have).
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-01 16:01:14 +0900
Author date: 2012-08-01 16:01:14 +0900
Commit id: 8fbcb6e1093b65a1ed476ef94915f817320b8145
Ignore nonexistent files.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-01 12:48:19 +0900
Author date: 2012-08-01 12:48:19 +0900
Commit id: 5bd8c70d573dfc79bdf67d13a296a2b9f2ec3576
Honor TMPDIR.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-01 11:50:22 +0900
Author date: 2012-08-01 11:50:22 +0900
Commit id: 8973ddc350becf57220e31efc63035762fa17b0a
Use the correct directory for cleaning the clonotype file.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-01 11:42:35 +0900
Author date: 2012-08-01 11:42:35 +0900
Commit id: 647aa419a5332b49b64f9d6e919f15d0007abc4e
Added a DEBUG option, and reduce the number of temporary files when not using it.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-01 11:37:48 +0900
Author date: 2012-08-01 11:37:48 +0900
Commit id: ef1efab3236e2080e4df5e635a4933dbbb31f9ef
Transfer a comment to the tips page.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-01 11:17:04 +0900
Author date: 2012-08-01 11:17:04 +0900
Commit id: 423cf824e3b9788c732c488440d3204949bcfa48
Extend common_clonotypes with a matrix mode.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-25 19:50:15 +0900
Author date: 2012-07-25 19:50:15 +0900
Commit id: f1bfc0d7c8eef54f18898057fdf812b7d4d8acc4
Reorganised the clonotype page, giving an example ane clarifying that the C and FGxG motif are not included.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-25 05:11:12 +0000
Author date: 2012-07-25 05:11:12 +0000
Commit id: 828365468658f5307b6dd08ccbc553cd438490f3
Link to the reference directory's README page.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-25 04:49:01 +0000
Author date: 2012-07-25 04:49:01 +0000
Commit id: b41c10020484c0bf65611f96bfab3ecd7b5bab4a
Polish the reference directory's README.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-25 13:45:43 +0900
Author date: 2012-07-25 13:45:43 +0900
Commit id: db8aff192824b7e5c0d9c4770c97c9ee7c0c828c
Removes dependance on moreutils by replacing the call to sponge.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-25 13:30:28 +0900
Author date: 2012-07-25 13:30:28 +0900
Commit id: e03a112b7e446ecb39ced21d74945f72b110d2e3
Moved FASTQ conversion instructions to the clonotypeR script.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-25 11:49:40 +0900
Author date: 2012-07-25 11:49:40 +0900
Commit id: 91bf372202d1437a8486acc7593bc4323a7ed617
Introduce clonotypes.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-24 12:45:31 +0000
Author date: 2012-07-24 12:45:31 +0000
Commit id: 00051fe58e0eeb6f149e0ce2d5f5a7cf6756a1b5
Link to clonotype page.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-24 12:40:59 +0000
Author date: 2012-07-24 12:40:59 +0000
Commit id: fbbd3166a535af18b0c5782f8918bc963ebc411c
Background to underline code and examples.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-24 21:24:35 +0900
Author date: 2012-07-24 21:24:35 +0900
Commit id: 04f0d2e87b2faf19bc940363b17d5785103c8630
Merge branch 'master' of ssh://clonotyper.branchable.com
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-24 21:02:15 +0900
Author date: 2012-07-24 21:02:15 +0900
Commit id: 380e1089011f44655d168fca132494d4c007e857
Data exploration in R.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-24 11:56:38 +0000
Author date: 2012-07-24 11:56:38 +0000
Commit id: 41c326181660ea9ca29a22ad42117e41102e6dc9
List Biostrings in the requirements.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-24 11:21:24 +0000
Author date: 2012-07-24 11:21:24 +0000
Commit id: aee84935a807a53ebb2347a37858cba816398673
Convenience target to build the R module.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-24 20:16:14 +0900
Author date: 2012-07-24 20:16:14 +0900
Commit id: 9a113329a4116a5bb16531a153ae01f254d4f70f
Ignore Git and Ikiwiki directories when building the R module.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-24 20:15:37 +0900
Author date: 2012-07-24 20:15:37 +0900
Commit id: 34a33012d0878dfcb4de8691171ecb9387fbc58c
Convenience target to call R CMD check.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-24 20:13:22 +0900
Author date: 2012-07-24 20:13:22 +0900
Commit id: 50dc075faad81c82b2a0d00f00a96bf54c722ffc
Stop on error.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-24 20:05:16 +0900
Author date: 2012-07-24 20:05:16 +0900
Commit id: 8109542596b9b1982495f023c769616bc94cb385
Default location for reference files, create clonotype directory if it does not exist.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-24 20:03:14 +0900
Author date: 2012-07-24 20:03:14 +0900
Commit id: bd429351a7e929b0b8efd87d0002d602d3306c1f
Miniaturise whole page header.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-24 19:03:05 +0900
Author date: 2012-07-24 19:03:05 +0900
Commit id: 49d8d5a5071ff575ca9916954a89ffaef199d100
Make the branchable action bar less visible.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-24 18:52:29 +0900
Author date: 2012-07-24 18:52:29 +0900
Commit id: fff2a99b1788ea2215284852c4137a263155df09
Removed subtitle.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-24 09:37:46 +0000
Author date: 2012-07-24 09:37:46 +0000
Commit id: 1762c0cda5668924b405fc324ed8f685c0a5b0d5
Mention alternative works.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-24 09:35:15 +0000
Author date: 2012-07-24 09:35:15 +0000
Commit id: 80b51287b661c50293f22c2341ffa0f87290dc23
Create directories if they do not already exist.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-24 09:28:28 +0000
Author date: 2012-07-24 09:28:28 +0000
Commit id: afab0c906ef95097fe5cf41669e07d3685a64fd6
Create $EXTRACT_DIR instead of stopping with an error if it is absent.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-24 18:25:21 +0900
Author date: 2012-07-24 18:25:21 +0900
Commit id: 8c13182f552c00c4dcd808c0317e9135dcb115e3
Transfer instructions from README to doc.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-23 21:55:04 +0900
Author date: 2012-07-23 21:55:04 +0900
Commit id: ecf7151fa47931e4bf6df118606c2762404d8181
Example analysis.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-23 21:48:48 +0900
Author date: 2012-07-23 21:48:48 +0900
Commit id: 110e5fc8c8a102b59dde301df45f27ed54d620c1
Link to example and manual page.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-23 21:47:35 +0900
Author date: 2012-07-23 21:45:31 +0900
Commit id: 62309082cc3d5f2d6cdff29d8a5b3b03d84ff6cf
Draft manual page.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-23 21:40:57 +0900
Author date: 2012-07-23 21:37:56 +0900
Commit id: 72edf13c5416d873a716a82ab0156c68db4cea2c
VJsplit: do not output the sequence passed to vectorstrip.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-23 21:35:18 +0900
Author date: 2012-07-23 21:35:18 +0900
Commit id: ff0a39ea2a4082ec0bbf0ab107556a50f300de80
Turn off verbosity by default.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-23 20:21:59 +0900
Author date: 2012-07-23 20:19:43 +0900
Commit id: b824c1f1d358f3a4c6095a63320a7417d03485b6
Test if $EXTRACT_DIR is present.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-23 20:21:57 +0900
Author date: 2012-07-23 20:19:18 +0900
Commit id: 657b84a11f9d67e9bb0400241c32ea353488b189
Point default paths to /etc and /usr/share.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-23 19:40:24 +0900
Author date: 2012-07-23 19:40:24 +0900
Commit id: ba7a6d27bf0f5e5c8115742da00679a45beb7745
Moving general documentation to a 'doc' folder.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-23 18:34:09 +0900
Author date: 2012-07-23 18:34:09 +0900
Commit id: 21e5820be3d6e8b5844161c4f93ea22bb22c920b
Moving general documentation to a 'doc' folder.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-23 18:33:25 +0900
Author date: 2012-07-23 18:33:25 +0900
Commit id: 1624e36c0995d729b6526f66c1e0dfee7c0bba5c
Example data from three 454 runs.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-20 18:30:22 +0900
Author date: 2012-07-20 18:30:22 +0900
Commit id: a6a6aa2d98c1af16420d4d2ef17a67992a93524f
More cosmetic typographical changes.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-20 09:18:43 +0000
Author date: 2012-07-20 09:18:43 +0000
Commit id: 7cf7386f69467833e72cbc53df74d14f4393f67b
Drafted workflow.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-20 08:28:18 +0000
Author date: 2012-07-20 08:28:18 +0000
Commit id: 234b4da7afa24f12c2df65f1ac1b25dd9251385b
Cosmetic typographical changes.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-20 06:58:15 +0000
Author date: 2012-07-20 06:58:15 +0000
Commit id: d3911ac5fa37787e9c9d0f667f00eac037e3930e
Link to create the workflow page.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-20 06:45:40 +0000
Author date: 2012-07-20 06:45:40 +0000
Commit id: 5a3447d6ab8baa1fd804321f17f3cff4762ff3b7
Ignore for R what Git ignores.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-20 13:46:04 +0900
Author date: 2012-07-20 13:46:04 +0900
Commit id: a3da418ec4034eec9248773155714f5d5121d7d8
Link R documentation to home page.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-20 13:39:40 +0900
Author date: 2012-07-20 13:39:40 +0900
Commit id: 0cebb909093538b3f27461fd442f1ee137781e4d
HTML documentation of the R package.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-20 13:05:44 +0900
Author date: 2012-07-20 13:05:44 +0900
Commit id: 9b3268609cb0d81b8a996d3903bc7f155a8825e1
Build the HTML documentation of the R package.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-20 13:04:57 +0900
Author date: 2012-07-20 13:04:57 +0900
Commit id: a112ecba087d380914f37d7a881cebe7fd42b717
Uppercase Bugs.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-19 19:49:46 +0900
Author date: 2012-07-19 19:49:46 +0900
Commit id: 015ea4901bf9f91ee8342bc063fb83e326c52c11
Moved the page for resolved bugs to the upper-case directory.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-19 19:44:37 +0900
Author date: 2012-07-19 19:44:37 +0900
Commit id: 9b9777f64fc6232d2897453a8175f317de208123
Removed `feedpages="created_after(bugs/no_commit_mails_for_new_pages)"`
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-19 01:49:46 +0000
Author date: 2012-07-19 01:49:46 +0000
Commit id: 87de09572d8ed59646625d2929b88bce1a3f691b
yassai.nomenclature returns incorrect values.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-19 01:48:07 +0000
Author date: 2012-07-19 01:48:07 +0000
Commit id: 457946564a564fc619af23d8ea1287dc4aea4979
Copied from ikiwiki's bugs page.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-19 01:45:21 +0000
Author date: 2012-07-19 01:45:21 +0000
Commit id: 3fdb95c79d1a2062bedcb66918c00ea5879e9c95
Copied from ikiwiki's bugs page.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-19 01:44:23 +0000
Author date: 2012-07-19 01:44:23 +0000
Commit id: 8c26833a69d608a2dd191b887206ecd6fa3d2e78
Added a link to the source code.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-19 01:38:04 +0000
Author date: 2012-07-19 01:38:04 +0000
Commit id: 894c2fd99fdf889525daaca025f3f1b7f7f24ddd
TODO: Support extraction of barcoded reads.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-19 01:35:50 +0000
Author date: 2012-07-19 01:35:50 +0000
Commit id: 5ccaae9f37ed68069917a74357e703ae252aa57f
Committed by: admin
Author Name: https://www.google.com/accounts/o8/id?id=AItOawnBeKsGItVOjWWGrYqYJDfn0hacxUHE0R4
Commit date: 2012-07-19 01:18:50 +0000
Author date: 2012-07-19 01:18:50 +0000
Commit id: 0b2a08f02fb74a1fce64539906660a0b29274c0f
Committed by: admin
Author Name: https://www.google.com/accounts/o8/id?id=AItOawnBeKsGItVOjWWGrYqYJDfn0hacxUHE0R4
Commit date: 2012-07-19 01:12:48 +0000
Author date: 2012-07-19 01:12:48 +0000
Commit id: 23c7f53c15a984ab80ed6b911bef69cc07721b7a
Corrected a typo.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-18 20:27:22 +0900
Author date: 2012-07-18 20:27:22 +0900
Commit id: dbcf051f8fc0345f298ae348e378f302103bab5b
Place clonotypeR in the public domain.
See: http://creativecommons.org/publicdomain/zero/1.0/
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-18 20:22:42 +0900
Author date: 2012-07-18 20:22:42 +0900
Commit id: 17c160a4224ae3d8f011d8b177a4f70b8e886c83
Index page.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-18 20:10:22 +0900
Author date: 2012-07-18 20:10:22 +0900
Commit id: 44b75a4381e6790186985666f33a10edcaed79ff
Merge branch 'master' of git+ssh://osc-lm/osc-fs_home/plessy/git/clonotypeR
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-18 20:08:24 +0900
Author date: 2012-07-18 20:08:24 +0900
Commit id: fda34793a1a8e8fa5a298e34ec3ac6f6bd04cf6b
Merge /home/plessy/git/clonotypeR
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-18 17:53:48 +0900
Author date: 2012-07-18 17:53:48 +0900
Commit id: 77799de49185890c7ae050b148795f14dcba25ad
initial commit
Committed by: admin
Author Name: admin
Commit date: 2012-07-18 03:56:07 +0000
Author date: 2012-07-18 03:56:07 +0000
Commit id: c3c98e1f1873691a926b21a6c3a193db0691c7b5
Attempt to load codon_ids if not found.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-17 19:36:16 +0900
Author date: 2012-07-17 19:36:16 +0900
Commit id: 65c20abd543e971a49c416c60d7eeeba9a847575
Workaround that actually does not work in the regression tests.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-17 18:56:24 +0900
Author date: 2012-07-17 18:56:24 +0900
Commit id: e2028c44097db1e04b1156c44281637d61bea985
Superseded by data/J_before_FGxG.R and data/V_after_C.R.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-17 18:10:36 +0900
Author date: 2012-07-17 18:10:36 +0900
Commit id: 2eba0f44b76672fb06c050a984bc72ed89496028
Corrected typo in J_before_FGxG.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-17 18:04:22 +0900
Author date: 2012-07-17 18:04:22 +0900
Commit id: b8aa6fb7436d6cda6197df5ef62faa5efba05d8a
Corrects a stupid bug. Never write programs in a rush before eating ! Always make tests !
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-14 13:39:25 +0900
Author date: 2012-06-14 13:39:25 +0900
Commit id: 289ca1b13c02db17eed38e00aae33429bd41f1e9
Depends: Biostrings.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-14 11:54:30 +0900
Author date: 2012-06-14 11:54:30 +0900
Commit id: 8e3d4fb21ee98811f064ddf1b9e3a14efa366ad9
Pre-load V_after_C" and "J_before_FGxG". Is that necessary ?
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-14 11:53:45 +0900
Author date: 2012-06-14 11:53:45 +0900
Commit id: 61cb7edfb7a54201319df952155b29f2ccbe181b
Link to common_clonotypes.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-14 11:53:28 +0900
Author date: 2012-06-14 11:53:28 +0900
Commit id: a54d69501aa48c80c1d644290563d93dc92776be
common_clonotypes: lists clonotypes common to two groups of samples.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-14 11:49:17 +0900
Author date: 2012-06-14 11:49:17 +0900
Commit id: d6ea4990313a6f222aa2e2ccc840f669180d9b63
Renamed to avoid confusion with generic functions.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-14 11:33:46 +0900
Author date: 2012-06-14 11:33:46 +0900
Commit id: 8dbbc4359b47c8f80da2d3d264b671a76484433c
Load V_after_C and J_before_FGxG file for calculating Yassai's nomenclature.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-12 21:28:35 +0900
Author date: 2012-06-12 21:27:57 +0900
Commit id: 9ca756a7a87dd5fc592783387de6ff2fa82ecdcb
Compressed so that they are found in the same path in the Git repository and the installed R library.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-12 21:07:32 +0900
Author date: 2012-06-12 21:07:32 +0900
Commit id: af1286faff89813f5f853eef96d661350b1cd603
Proofread documentation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-12 20:53:36 +0900
Author date: 2012-06-12 20:53:36 +0900
Commit id: d350a525f229bab443615e2847be97f9145846df
Renamed to avoid confusion with generic functions.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-12 20:44:15 +0900
Author date: 2012-06-12 20:44:15 +0900
Commit id: 4fc5bb4c2cc97fd7e55e320c3352e479f54d2284
Corrected code/documentation mismatches.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-11 19:01:46 +0900
Author date: 2012-06-11 19:01:46 +0900
Commit id: 3c39536ca0f8921293929342f1c9785786285e48
Document filters option of clonotype.table.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-11 18:52:32 +0900
Author date: 2012-06-11 18:52:32 +0900
Commit id: 7da963bd688f19f13c350759e59ae75590a0783b
Corrections for empty entries.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-11 18:41:20 +0900
Author date: 2012-06-11 18:41:20 +0900
Commit id: 842cbf83f24ddfdc01e38a2904967cb1c667e0cb
Corrected data name.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-11 18:35:36 +0900
Author date: 2012-06-11 18:35:36 +0900
Commit id: 3e48079cc0d3f747232d6d1ab4dcde79f3fa1e3b
Renamed codon_ids.table.txt to match man/data-codon_ids.Rd.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-11 17:00:19 +0900
Author date: 2012-06-11 17:00:19 +0900
Commit id: 601a7072a32d20e8d3eb5f2ecbf5c2c92c1786f7
ASCII quotes to simplify encoding.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-11 16:56:33 +0900
Author date: 2012-06-11 16:56:33 +0900
Commit id: fe9d1e38804a7ac7c52c3bac3a19518fa8acc840
Correct documentation links.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-05-16 16:47:44 +0900
Author date: 2012-05-16 16:47:44 +0900
Commit id: 53b4aa6893a7f1e609fe7c26be703c34ee6ca354
Corrected documentaion example.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-05-16 16:26:40 +0900
Author date: 2012-05-16 16:26:40 +0900
Commit id: ced03a73c0cc4becd4285ff4b673fd8e8b7274d9
Use the provided clonotype table instead of the previously hardcoded one.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-05-16 16:24:53 +0900
Author date: 2012-05-16 16:24:53 +0900
Commit id: 00aed02d14797f986f23c15cf269d4a752f33704
Exit with error if filename is an empty string.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-05-16 16:18:18 +0900
Author date: 2012-05-16 16:18:18 +0900
Commit id: f120a81e0fd88beb3d4c408db9841c3a3c0cb9b8
Dedicate to public domain (to be confirmed by public release).
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-05-16 16:05:15 +0900
Author date: 2012-05-16 16:05:15 +0900
Commit id: 73621a30be2c8c23a10fafb2ec19979851106b75
Corrected markup syntax errors.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-05-16 15:47:51 +0900
Author date: 2012-05-16 15:47:51 +0900
Commit id: 00ac560dbc024b2e958367e3ce5805df40193767
Correction of how to load example data.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-04-24 20:44:21 +0900
Author date: 2012-04-24 20:44:21 +0900
Commit id: 8afb7daf712b6af1c787aa69fa66d17f0b7b028f
Syntax correction.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-04-24 20:41:34 +0900
Author date: 2012-04-24 20:41:34 +0900
Commit id: c1913a3da561be08528be6372365343a6c0a6efe
Syntax corrections.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-04-24 20:18:33 +0900
Author date: 2012-04-24 20:18:33 +0900
Commit id: 99c3c73fea6e5cb8b4eea47dfb021bb729339b8a
Do more regression tests.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-04-24 20:18:00 +0900
Author date: 2012-04-24 20:18:00 +0900
Commit id: 357f8c5faa6d4ac7c6ebe3c60ee2e0f5f68930dd
Abort if no "improductive" column is found.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-04-24 20:17:27 +0900
Author date: 2012-04-24 20:17:27 +0900
Commit id: 105b91829fec2ead2a6988b8e845e7fa9732142a
Corrected to also accept the OSCT format.
Order Switchable Column Table (OSCT): http://sourceforge.net/projects/osctf/
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-04-05 21:15:17 +0900
Author date: 2012-04-05 21:15:17 +0900
Commit id: 85c55309a1a390a84dc7c9b57e304e62ef869502
Closes example section.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-03-30 19:40:56 +0900
Author date: 2012-03-30 19:40:56 +0900
Commit id: 743444726e12ea782c6ca3d018bb3f324b138f14
Re-indexed using BWA 0.6.1-r104.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-03-28 15:41:31 +0900
Author date: 2012-03-28 15:41:31 +0900
Commit id: c2fc8bfd29f3d2819734c57db907a62cf19e173d
Default directories for extraction.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-03-14 20:09:45 +0900
Author date: 2012-03-14 20:09:45 +0900
Commit id: bfbc7d135702a3f59ac8ac53c5b5047f6f71de08
Tweaks to allow exection from any directory.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-03-01 19:27:53 +0900
Author date: 2012-03-01 19:27:53 +0900
Commit id: acf2ca9cae299fed66c4175785f00cbe6eb1a59e
clontyperR {convert|detect|extract}
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-03-01 15:12:18 +0900
Author date: 2012-03-01 15:12:18 +0900
Commit id: dbd6825403c669a58f8ddfff892d404a35c1d955
Removed suffix.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-03-01 15:03:56 +0900
Author date: 2012-03-01 15:03:56 +0900
Commit id: 86929836cbbc33a4a28451aa7fcf0b7786117886
Added a “clean” target.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-03-01 14:56:08 +0900
Author date: 2012-03-01 14:56:08 +0900
Commit id: 32f65255e3b94257c273bfb956e81d8f0e37a60d
Polishing.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-02-08 17:56:39 +0900
Author date: 2012-02-08 17:56:39 +0900
Commit id: 014a9447214b8f40f53b5352b9f9a55dfcd6e02f
Polishing documentation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-02-08 16:38:28 +0900
Author date: 2012-02-08 16:38:28 +0900
Commit id: 6a7b0d1672f7c0f5541c51edee914434e52bf3b0
Typography.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-02-08 16:06:23 +0900
Author date: 2012-02-08 16:06:23 +0900
Commit id: 2d1373fc10063873145b5c5f0f3ee27905bf9d6f
Added a “all” target.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-02-08 15:46:09 +0900
Author date: 2012-02-08 15:46:09 +0900
Commit id: 0e4a5040ec2a720a9f40e947decb37b39a1a6288
Need more example data.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-02-08 15:45:35 +0900
Author date: 2012-02-08 15:45:35 +0900
Commit id: 446bc0f82175623f9757384e7b08478b3813b3da
Added URL to BioPerl.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-02-08 15:38:19 +0900
Author date: 2012-02-08 15:38:19 +0900
Commit id: d063e96963be169fa08c864ae34f0e28048b4ee6
Rough implementation with codon IDs. Needs triplechecking.
V and J segment names need to be corrected.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-01-31 21:50:46 +0900
Author date: 2012-01-31 21:50:46 +0900
Commit id: 54db3f0b0b5aa0cf85bdecc1510c42e81c5ba5cc
Documented what the code is doing.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-01-31 20:59:16 +0900
Author date: 2012-01-31 20:59:16 +0900
Commit id: b146a6e49da766c2e1e12cde68e7d5ea7b2f0b24
Attempt at pre-loading J_before_FGxG and V_after_C.
This will probably not work du permier coup.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-01-31 20:49:31 +0900
Author date: 2012-01-31 20:49:31 +0900
Commit id: 33f349b81daf0a93522947ec322817870cdbe495
Replace NA per FALSE; is.somatic is used in a while loop.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-01-30 22:03:28 +0900
Author date: 2012-01-30 22:03:28 +0900
Commit id: aea439fafba06808caa7e4c63e52a9aaf88c2dbe
First step to implement Yassai's nomenclature: the CDR3.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-01-30 21:27:56 +0900
Author date: 2012-01-30 21:27:56 +0900
Commit id: bca53f58171a8531527c27ba95dce30ec612d9bf
Added codon ID table for the Yassai nomenclature.
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC2706371/table/Tab1/
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-01-30 16:12:14 +0900
Author date: 2012-01-30 16:12:14 +0900
Commit id: b4719e4cb8ec41af182655dfcbfdbefd6168b63d
Preparing the use of the OSCTable format.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-12-08 13:16:07 +0900
Author date: 2011-12-08 13:16:07 +0900
Commit id: efd107dea8443a28cc323499ad8817a3930168ae
Draft instructions and script to extract clonotypes.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-11-17 16:03:45 +0900
Author date: 2011-11-17 16:03:45 +0900
Commit id: 9d7dbca10624f2c17aeecd66c27012ef786f133d
Standardised options, shortened error messages, added one check.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-11-16 20:20:20 +0900
Author date: 2011-11-16 19:33:21 +0900
Commit id: c550e00f807a29c1289df2c295315696f127a880
Reordered options in clonotype.table, and corrected for single libraries.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-11-16 18:50:18 +0900
Author date: 2011-11-16 18:50:18 +0900
Commit id: df93f52d317c28460043b0eb3e3dc58c369c843b
A function to list unique clonotypes.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-11-14 16:36:16 +0900
Author date: 2011-11-14 16:36:16 +0900
Commit id: fac03e7856569142cda91dc03634ba8e25f006ad
New function to prepare clonotype tables.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-11-08 22:09:24 +0900
Author date: 2011-11-08 22:09:24 +0900
Commit id: eaf026e1561dffb78d2de39fc512c43464d966f9
Test data using three libraries.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-11-08 22:08:24 +0900
Author date: 2011-11-08 22:08:24 +0900
Commit id: c9ba9d9961824143a0377da909715ec84a5ab71c
Integrate the calculation of the eight column: improductive rearrangements.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-11-08 21:26:40 +0900
Author date: 2011-11-08 21:26:40 +0900
Commit id: d51893483065123767653044ff73a714d10aa685
Function “read.clonotypes” to load a clonotypes file, and example data.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-11-04 22:17:34 +0900
Author date: 2011-11-04 22:06:06 +0900
Commit id: adb605e8a90ec5639d854a91e994a57a5684e794
BWA index of trimmed V segments.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-10-31 14:47:00 +0900
Author date: 2011-10-31 14:47:00 +0900
Commit id: 30576e3dc2856f96a67a7dc5226df8a2a0810824
Reference V and J segments trimmed at C or FGxG motifs.
Needed for V-J extraction by the “VJsplit” script.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-10-31 14:27:37 +0900
Author date: 2011-10-31 14:27:37 +0900
Commit id: 8c2f82eda0e73ad7f4f77bebc72e5cea04c3a9d3
Reference V and J alignment (made by hand using SeaView).
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-10-31 14:27:16 +0900
Author date: 2011-10-31 14:24:21 +0900
Commit id: 700b879cd76980cf45ab9dfdfdfc242551608fc7
Extraction of the V, (D), J and C segments from the reference sequences.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-10-31 14:23:42 +0900
Author date: 2011-10-31 14:05:23 +0900
Commit id: 1363b60e26074401ff9cf1f2b62e2ecd44217ac1
Added reference TCR genes from RefSeq, but BCRs and update helper are needed.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-10-31 12:13:35 +0900
Author date: 2011-10-31 12:13:35 +0900
Commit id: dc77dc1264965d79f786f355f1e91e987132de3d
Initial empty master branch.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-10-31 12:13:00 +0900
Author date: 2011-10-31 12:13:00 +0900
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@94506 bc3139a8-67e5-0310-9ffc-ced21a209358
Consists of 380 commits.
Commit information:
Commit id: de449193bde6e56a204d3b12c7f4e489a780e4b2
Merge branch 'bioc'
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-09-25 11:00:49 +0900
Author date: 2014-09-25 11:00:49 +0900
Commit id: 0838bc06272e87c0690f093a017cde8a9cc10313
News entry for the new stable release.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-06-05 19:40:12 +0900
Author date: 2014-06-05 19:40:12 +0900
Commit id: 67aa2eac309df5bf8d5dbc790661db102145d692
Does not work with EMBOS 6.6.0.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2014-06-05 05:22:35 +0000
Author date: 2014-06-05 05:22:35 +0000
Commit id: fe4ae4f131d3c5fc8d5aebd5873d7de109c1b0b7
Should use `basename` canse-insensitively…
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2014-06-04 22:38:29 +0000
Author date: 2014-06-04 22:38:29 +0000
Commit id: 517e35af4a8ad194bed6ea3d187c73e5b97490b7
Merge branch 'bioc'
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-04-09 12:45:46 +0900
Author date: 2014-04-09 12:45:46 +0900
Commit id: 23598ee1b592a99be9cf58602b0f214c2980453a
Merge branch 'bioc'
Conflicts:
DESCRIPTION
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-04-08 15:45:15 +0900
Author date: 2014-04-08 15:45:15 +0900
Commit id: d404d2c8f9b682404b64d2d5e8deb29954edc499
Merge branch 'bioc'
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-04-03 14:03:24 +0900
Author date: 2014-04-03 14:03:24 +0900
Commit id: bd21f9c77e7083e183d22287c4f79e8c6161d62e
Documentation updates.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-04-03 14:02:11 +0900
Author date: 2014-04-03 14:02:11 +0900
Commit id: 8a633d4908bd1176d9dced6ba47acfc469aa7a3f
Merge branch 'bioc'
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-04-03 13:49:30 +0900
Author date: 2014-04-03 13:49:30 +0900
Commit id: bb7e511573b44b0ecd95e5d643dceb6adcc103a2
Merge branch 'bioc'
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-04-03 13:19:06 +0900
Author date: 2014-04-03 13:19:06 +0900
Commit id: de328b9f0a5035662eb934d79dd876ae72a1ba0b
Merge branch 'master' of ssh://clonotyper.branchable.com
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-04-03 11:28:17 +0900
Author date: 2014-04-03 11:28:17 +0900
Commit id: d16322c96db5046f113bfa982e8a621444324ab5
Merge branch 'bioc'
Conflicts:
DESCRIPTION
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2014-04-03 11:27:03 +0900
Author date: 2014-04-03 11:27:03 +0900
Commit id: 2767b62c7c87359ca87daaf28e4ec5dec44a5b6f
No full source archive available for the moment.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-12-19 16:21:39 +0000
Author date: 2013-12-19 16:21:39 +0000
Commit id: 56784b6503a5de8205789f19a23bbf40cf9750ea
Commited 1.1.3 to Bioconductor.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-12-11 19:27:09 +0900
Author date: 2013-12-11 19:27:09 +0900
Commit id: d2488356f56b6c332a4796d2d3f0245bfcc5e558
Indicate the position of the V-J junction when there is no codon ID to indicate.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-12-11 19:19:01 +0900
Author date: 2013-12-11 19:19:01 +0900
Commit id: ef4a8fe53efae1baa5df16677edbac30911463ff
Flag and exclude ambiguous DNA sequences.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-12-11 17:59:27 +0900
Author date: 2013-12-11 17:59:27 +0900
Commit id: fe95743d1153f6288c987a796ad710b6fba2f1c6
Merge branch 'master' of ssh://clonotyper.branchable.com
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-12-11 14:31:03 +0900
Author date: 2013-12-11 14:31:03 +0900
Commit id: 08727c97529f33931c5d13aeff3e16dc39c29ab7
Problem solved by better checking the input.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-12-11 05:29:37 +0000
Author date: 2013-12-11 05:29:37 +0000
Commit id: e4d102a595c15459574a5a175124aac69ac9952b
Added example.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-12-11 05:26:15 +0000
Author date: 2013-12-11 05:26:15 +0000
Commit id: 2b8514d18f312f627255b0f2eb0ec1bf4ffa48dd
Return empty chain instead of integer(0) when receiving an empty chain.
Closes: Incorrect_identifiers_when_V-J_boundary_is_a_codon_boundary_
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-12-11 14:26:05 +0900
Author date: 2013-12-11 14:26:05 +0900
Commit id: cb56f5611fc8532cac80bf527b1d9e8d8524586e
Broke the infinite loop.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-12-11 05:23:48 +0000
Author date: 2013-12-11 05:23:48 +0000
Commit id: bc0c6046cdfbb32a74a0741548015e01f0c5f659
Merge branch 'master' of ssh://clonotyper.branchable.com
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-12-11 14:21:45 +0900
Author date: 2013-12-11 14:21:45 +0900
Commit id: 42ab98729c5c77462b5929b00ee973074ae4c1c7
Break infinite loop when the whole CDR3 sequence is identical to the germline reference.
Closes: Clonotype_that_takes_ages_for_calculating_the_Yassai_identifier.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-12-11 14:19:17 +0900
Author date: 2013-12-11 13:33:04 +0900
Commit id: e6f8d079888dc3dcffe677ef1a042313fc03c817
Alignment to the J region is correct as well.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-12-05 08:23:41 +0000
Author date: 2013-12-05 08:23:41 +0000
Commit id: da4a4c5f6c41041d48fda34cb05ce8ba908cd47c
Alignment of the V region is correct.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-12-05 08:22:03 +0000
Author date: 2013-12-05 08:22:03 +0000
Commit id: 51e8e91ca69d36b2ec625de2b61c6c21d3663819
Escaped using the Highlight command
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-12-05 07:59:07 +0000
Author date: 2013-12-05 07:59:07 +0000
Commit id: eb7eaedbf22419eaa200afd8dd97d4ff7c1f782f
Alignment in SAM format.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-12-05 07:46:39 +0000
Author date: 2013-12-05 07:46:39 +0000
Commit id: a3b445a51fe755d691cf87b9533933d50c71ee94
Found the problematic read.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-12-05 07:44:59 +0000
Author date: 2013-12-05 07:44:59 +0000
Commit id: 47bba4876cbe49b3a6415bbb4f6f6a6a3007ce41
Found a clonotype that makes yassai_identifier() very slow.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-12-05 05:41:02 +0000
Author date: 2013-12-05 05:41:02 +0000
Commit id: 261d18f4a8f6a042c2d9602e352df47412bad27d
Refreshed documentation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-12-05 13:21:34 +0900
Author date: 2013-12-05 13:21:34 +0900
Commit id: 8b85bb373c930b6f1ef506b3ade2bbbc569d3775
New "long" option to yassai_identifier(), to avoid collisions.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-12-05 13:21:12 +0900
Author date: 2013-12-05 13:21:12 +0900
Commit id: 00f4895d4a172de8fd3109125fc1435e6b2d06a2
Cosmetic reorganisations.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-12-05 11:34:27 +0900
Author date: 2013-12-05 11:34:27 +0900
Commit id: 0ff5028ed5f320f1e5c75d4657f0bcee6c9c49dd
Simplification and standardisation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-12-05 11:22:40 +0900
Author date: 2013-12-05 11:22:40 +0900
Commit id: 2232d06fa83e353a95cc31851b904d19de8711d6
Another software for analysing TCRs.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-11-20 00:56:00 +0000
Author date: 2013-11-20 00:56:00 +0000
Commit id: 95b2833ad6e5882f1d3f34615830512b51db1da4
Actually, in this collision the translations are different.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-11-20 00:49:14 +0000
Author date: 2013-11-20 00:49:14 +0000
Commit id: baed72501169ddf3ff3d891131f2dfc73a366aec
Corrected aminoacid sequence. Finally, this is a collision.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-11-20 00:44:39 +0000
Author date: 2013-11-20 00:44:39 +0000
Commit id: c32e4a3cc8444cd5e593f1c31a7e359112fbd827
Latest versions on NCBI, updating TRDV5.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-11-19 20:33:32 +0900
Author date: 2013-11-19 19:47:15 +0900
Commit id: f4d3784867dfea3890eaed4612f99fd847c77915
Corrected a typo.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2013-11-19 10:32:20 +0000
Author date: 2013-11-19 10:32:20 +0000
Commit id: 3ca955591dfc25fc68d092b4943ed216ca8e821d
Not a bug.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-11-19 00:42:05 +0000
Author date: 2013-11-19 00:42:05 +0000
Commit id: 08d60b3329e96780e6ec1d339302b088f6ca7f60
Split by codons.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-11-19 00:34:29 +0000
Author date: 2013-11-19 00:34:29 +0000
Commit id: b60fca260bd7b9a65982123de01c7c42b1ba3daa
Different clonotypes give same ID ?
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2013-11-19 00:29:48 +0000
Author date: 2013-11-19 00:29:48 +0000
Commit id: d9b8de3e75728ad5b1d2a2155bd433843f4f1c8f
Bug in yassai_identifier()
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2013-11-18 10:42:49 +0000
Author date: 2013-11-18 10:42:49 +0000
Commit id: 606a691a190592d7cff6038811ebe0b1f04f0049
Corrected a typo.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-31 18:12:47 +0900
Author date: 2013-10-31 18:12:47 +0900
Commit id: 1784e2b9312999da0a70da26df0cadd0880494fc
clonotype_table: new option to randomly "sample" libraries.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-23 19:57:59 +0900
Author date: 2013-10-23 19:57:59 +0900
Commit id: 9ff7927026d58cd082f284097fec448118640f6b
No default table anymore.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-23 18:01:25 +0900
Author date: 2013-10-23 18:01:25 +0900
Commit id: 36f5e57c35b86a59329a33028b5cf8250af84def
Corrected minor formatting error in the documentation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-23 17:08:50 +0900
Author date: 2013-10-23 17:08:50 +0900
Commit id: 1702447155fa521184444ec18f7b3c54cbe27b38
Refreshed HTML documentation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-17 19:00:24 +0900
Author date: 2013-10-17 19:00:24 +0900
Commit id: 04608179a93c4f6710e92b8f48b8afe1070bf5c8
common_clonotypes: new mode to calculate the "abundance" relatively to one library.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-17 19:00:03 +0900
Author date: 2013-10-17 18:50:10 +0900
Commit id: 6df141e961f24c6c5cbfd4a0a13ca3eac7274b19
Double the speed, taking advantage of the symmetry.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-17 15:55:45 +0900
Author date: 2013-10-17 15:55:45 +0900
Commit id: 13e106a7bcf2bac307b74dbe37c347e391c76db0
Made common_clonotypes a S4 function.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-17 15:50:56 +0900
Author date: 2013-10-17 15:50:56 +0900
Commit id: 6db01d0bbb9476e645977090a7b0bec8e245ef9e
Merge branch 'master' of ssh://clonotyper.branchable.com
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-16 16:21:15 +0900
Author date: 2013-10-16 16:21:15 +0900
Commit id: a7f701ba0e21c8a801115c90c7d50b4f11f72f7c
New development branch.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-16 15:52:17 +0900
Author date: 2013-10-16 15:52:17 +0900
Commit id: 5ea2135a5e302b8adafcf7edb8012b6a471051d1
Point to the stable version of Bioconductor.
Committed by: admin
Author Name: https://plessy-riken-jp.myopenid.com/
Commit date: 2013-10-15 22:47:14 +0000
Author date: 2013-10-15 22:47:14 +0000
Commit id: 877d38c95c8e21f41747030426b4844f1600e945
Point to the stable version of Bioconductor.
Committed by: admin
Author Name: https://plessy-riken-jp.myopenid.com/
Commit date: 2013-10-15 22:46:35 +0000
Author date: 2013-10-15 22:46:35 +0000
Commit id: 17952327295bd9a862d9295db23b8dda4ebc9e46
Updating description and releasing 0.99.6.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-07 20:32:00 +0900
Author date: 2013-10-07 20:31:37 +0900
Commit id: 167637b6e6bbd928a3800d42518cb0ec93d32474
Correct syntax error.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-07 20:28:49 +0900
Author date: 2013-10-07 20:28:49 +0900
Commit id: 9e2e2de37a8d8aca10e2c07898b38a1059709bbe
Refreshed.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-07 20:27:26 +0900
Author date: 2013-10-07 20:27:26 +0900
Commit id: b3008e36c563446be4fb08cde93826059da07ce6
Mention Bioconductor on the front page.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-07 20:26:58 +0900
Author date: 2013-10-07 20:26:58 +0900
Commit id: 5796401be556310df17e32e4318d54ef7d7f85c7
Added unit tests for yassai_identifier(), and unbroke it by the way.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-07 19:55:01 +0900
Author date: 2013-10-07 19:55:01 +0900
Commit id: 1b0ed175787e98c38fea3fd8a5e5d6c8cd408545
Unbreak again the output when there is only one clonotype.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-07 19:44:50 +0900
Author date: 2013-10-07 19:44:50 +0900
Commit id: 5d9f507c1f2bc79148ce95ec33bc62c3b2a5ca2c
Corrected minor syntax error.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-10-07 19:28:32 +0900
Author date: 2013-10-07 19:28:32 +0900
Commit id: 246b1e3ed20695e559bba51356a2a7cc9ce60c25
The `R` package is also distributed on Bioconductor.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-08-02 13:30:45 +0900
Author date: 2013-08-02 13:30:45 +0900
Commit id: 0d29dcd812655bb18f6da99b83ea457e394895e5
Unified the syntax of common_clonotypes and unique_clonotypes.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-08-01 11:22:19 +0900
Author date: 2013-08-01 11:22:19 +0900
Commit id: bff994b1f14ab6665eedc15598df5e83ae8254b0
Resubmitted clonotypeR_0.99.5.tar.gz to Bioconductor.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-05-07 21:28:42 +0900
Author date: 2013-05-07 21:28:42 +0900
Commit id: 215825af72dc8d3369b1e9dad056673ca2fcada1
Add vignette to html_doc; refresh.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-05-07 21:14:47 +0900
Author date: 2013-05-07 21:14:47 +0900
Commit id: fbfe17c884da59b2a3bbab07575971eb588bd12e
Rework vignette to use additional example data.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-05-07 21:08:06 +0900
Author date: 2013-05-07 21:08:06 +0900
Commit id: 6e3d48de97f5df855917fc55ed06ff7f315ee3a1
Clonotypes extracted from example_data.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-05-07 20:51:18 +0900
Author date: 2013-05-07 20:51:18 +0900
Commit id: 8de1988b83f118767b0abfabb988ad769a7dcabf
Corrected a typo.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-05-07 11:41:02 +0000
Author date: 2013-05-07 11:41:02 +0000
Commit id: f1a95ffc338cc9628aa043f8a2319efe33caec09
No time today.
Committed by: admin
Author Name: https://launchpad.net/~plessy
Commit date: 2013-05-07 11:38:20 +0000
Author date: 2013-05-07 11:38:20 +0000
Commit id: 815fbcbae66770f01649bd9c7e65f90569240b4f
Added executable example with test data to the vignette.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-05-01 21:55:33 +0900
Author date: 2013-05-01 21:54:32 +0900
Commit id: 5e658adbd8fb8a2b34511f2f0e9db94335145b0e
Moved vignettes to root for automatic building.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-05-01 21:52:46 +0900
Author date: 2013-05-01 21:52:46 +0900
Commit id: 963544b03c57819095ba459d46ebed561d9762d0
Resubmitted 0.99.3 to Bioconductor.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-26 13:29:56 +0900
Author date: 2013-04-26 13:29:56 +0900
Commit id: 21de5ed25d5afb0bb7e5c9cab6b3105e98a99f52
Refreshed documentation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-26 13:25:26 +0900
Author date: 2013-04-26 13:25:26 +0900
Commit id: 287c9829612cd1a0407b9d15178ad5548fc50396
Describe the extra data in a common manual page.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-26 13:24:15 +0900
Author date: 2013-04-26 13:24:15 +0900
Commit id: b5e5bc8c46e47174722c054b419360a9a256b30a
Correct source code and documentation after moving data to 'inst/extdata'.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-26 12:46:41 +0900
Author date: 2013-04-26 10:40:12 +0900
Commit id: dfe97762cf7c1e827de216bbcbf056bbfeacd4f3
Moved data to 'extdata' as it is not in the '.Rd' format.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-26 10:34:58 +0900
Author date: 2013-04-26 10:34:58 +0900
Commit id: 6e27d1f7f50aa721240da77a763b09e64fe1e8ef
Renamed 'doc' director to 'vignettes' to enable auto-building of the knittr vignette.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-26 10:30:56 +0900
Author date: 2013-04-26 10:30:56 +0900
Commit id: 14f4c3a0fd67591d930df4a550cf9ea25fa8cc53
Refreshed documentation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-18 09:22:59 +0900
Author date: 2013-04-18 09:22:59 +0900
Commit id: f84db0e8fdcb1a6c03b81c4230c2b8b5c9504a26
0.99.2
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 21:56:30 +0900
Author date: 2013-04-15 21:56:30 +0900
Commit id: 7cf966e77891afcb2d85aa25600cd07c661df9ec
Declare methods.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 21:54:25 +0900
Author date: 2013-04-15 21:54:25 +0900
Commit id: 87ab884780b23897a64a17679b23de4271ed65c0
Declare encoding.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 21:54:14 +0900
Author date: 2013-04-15 21:54:14 +0900
Commit id: 022bebfd23ea34b53cd0c66144481296e0e6832b
Point to license file instead of using unknown keyword (CC0).
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 21:30:48 +0900
Author date: 2013-04-15 21:30:48 +0900
Commit id: c6def55b5a3b83452d39323ef8747de9d065a230
Mention that the V and J data can be changed.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 21:30:17 +0900
Author date: 2013-04-15 21:30:17 +0900
Commit id: 54772072fccb68a5f775c3d0091c6ce6abff20fa
Mention that the data is from mouse.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 21:28:43 +0900
Author date: 2013-04-15 21:28:43 +0900
Commit id: 696cb2bc3af330f78f025ffb8092d9f5c2c78427
yassai_identifier: correct multiple output bug when input is a single clonotype.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 21:15:12 +0900
Author date: 2013-04-15 21:15:12 +0900
Commit id: edd71c4cce53992e8adc97afa27acb59c42267df
Call S4 methods only.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 20:33:28 +0900
Author date: 2013-04-15 20:33:28 +0900
Commit id: c0118e3fc2c9f472bab223dd30b31f5fee3e8468
yassai_identifier: load codon_ids as characters.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 20:22:17 +0900
Author date: 2013-04-15 20:22:17 +0900
Commit id: 5bddce379f902d859e3a7667a8386786c91e5e47
Load data from within function; remove un-necessary checks.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 20:01:00 +0900
Author date: 2013-04-15 20:01:00 +0900
Commit id: 7722f3669a425ee6cc78257437479353e7609479
Use a S4 method to facilitate the change or reference sequences.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 19:15:00 +0900
Author date: 2013-04-15 19:15:00 +0900
Commit id: b4aa7dbfadcc4c5179ff513a8acbc37e2c01032a
Replace DOI by PMID.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 16:32:17 +0900
Author date: 2013-04-15 16:32:17 +0900
Commit id: cd259b4799e155c52039a17bf3d0b4cc25ea8f93
Mention Decombinator.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 16:30:25 +0900
Author date: 2013-04-15 16:30:25 +0900
Commit id: 4e780a457c5b8f522a61cea1f4309de109d30c72
Mention that only mouse is supported currently.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 14:43:09 +0900
Author date: 2013-04-15 14:43:09 +0900
Commit id: c7e4dcbd016e84a0b8be69243a054e1655053c91
Correct confusion between human and mouse.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 14:22:16 +0900
Author date: 2013-04-15 14:22:16 +0900
Commit id: e064fc66e7bac6a8c98b59b45e519a660539fca4
Link to RefSeq's TCR loci for Human.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 14:07:41 +0900
Author date: 2013-04-15 14:07:41 +0900
Commit id: a3b6ea1cac7c3fbeb4366f169cde34722c3e0b94
Delete old PDF vignette.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 13:45:49 +0900
Author date: 2013-04-15 13:45:49 +0900
Commit id: 5781783e0dd3868e503c7ee3d98188607fc843c2
Do not build a PDF vignette.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 13:45:33 +0900
Author date: 2013-04-15 13:45:33 +0900
Commit id: b9d0aa92434f360b3f23e8eb05c0da65c90d2ea5
Refreshed PDF vignette.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 13:29:35 +0900
Author date: 2013-04-15 13:29:35 +0900
Commit id: 906aadcd4932fe78b48a539d7aebeb8d33922283
Update date.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 13:28:45 +0900
Author date: 2013-04-15 13:28:45 +0900
Commit id: 8c423487f471c52a3b6ec21a232ec7d23b097bbb
Adjust whitespace.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 13:26:51 +0900
Author date: 2013-04-15 13:26:51 +0900
Commit id: d7457f354d8bc9b8e0b945ef8eb289236aafb004
Use knitr::knitr as in the R-exts manual.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 13:23:40 +0900
Author date: 2013-04-15 13:23:40 +0900
Commit id: 8fe447b31ba96d887d5fbd7c6e48dc7f717505a1
Correct whitespace.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 13:18:36 +0900
Author date: 2013-04-15 13:18:36 +0900
Commit id: e3671747c8ed17e5365e3b26b26d894fe1541dc6
Minor change of the auto-generated documentation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 13:13:27 +0900
Author date: 2013-04-15 13:13:27 +0900
Commit id: 7518dec2320343ae89a82ae05d0ed109eb87d1df
Build vignette with Knitr.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 13:12:08 +0900
Author date: 2013-04-15 13:12:08 +0900
Commit id: 3934ced36d088184ccca45de2871e82b8cbf5589
Vignette inspired from doc/examples/with_test_data.mdwn.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 11:38:05 +0900
Author date: 2013-04-15 11:38:05 +0900
Commit id: d0d8ff9cdea8a21b07a63fcba84b833689bf65d1
Use a syntax similar to the Markdown vignette.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 11:36:45 +0900
Author date: 2013-04-15 11:36:45 +0900
Commit id: 67a7959b669482499a9cac1b06dad42d864cbc05
Removed spurius line.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 11:23:49 +0900
Author date: 2013-04-15 11:23:49 +0900
Commit id: 1490559fb26a4f2e34042177b1bc5e025972bfe2
Build vignette with knitr.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 10:25:44 +0900
Author date: 2013-04-15 10:25:44 +0900
Commit id: ad181fefec0beea6628cae73c8d8ed0b166c0783
Preparing conversion to Markdown format.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-15 10:22:29 +0900
Author date: 2013-04-15 10:22:29 +0900
Commit id: 268c48c41d9fdb654d440134a705e4c1ddf85c78
Update affiliations.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-12 09:29:43 +0900
Author date: 2013-04-12 09:29:43 +0900
Commit id: 5f13c20bcc6616c64a6e17c0c37ce1e7cf8e6ce1
Mention the CLST.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-11 09:55:58 +0900
Author date: 2013-04-11 09:55:58 +0900
Commit id: 6daa7dc64bb4b527677048fa61249238e300ad1b
Mention the OSC as recipient of the MEXT grant.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-08 14:56:02 +0900
Author date: 2013-04-08 14:56:02 +0900
Commit id: 05c8fc7b9777cf498da5d1e9e413e35681ab08f0
Mention acknowledgement and license in README.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-04-08 13:44:56 +0900
Author date: 2013-04-08 13:44:56 +0900
Commit id: c0434a694d7371a69d7665e28c2649f1432bc209
Refreshed HTML documentation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-02-27 14:35:05 +0900
Author date: 2013-02-27 14:35:05 +0900
Commit id: c69abf1c31fb192496dfbe2b254e782afea5d8e8
clonotypes.txt.gz: moved from data to inst/extdata.
It has to ble loaded through read_clonotypes.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-02-27 13:58:47 +0900
Author date: 2013-02-27 13:58:47 +0900
Commit id: d81ac599776ecbf97d498537bf064532942d9168
Recompressed the data files.
This makes the source repository similar to the binary package.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-02-27 13:38:14 +0900
Author date: 2013-02-27 13:21:33 +0900
Commit id: 388c8e69dab3642f11cee5349c6a8019819b7a80
yassai_identifier: disambiguate 'head' to 'header'.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-02-27 11:21:10 +0900
Author date: 2013-02-27 11:21:10 +0900
Commit id: e3faba5989703e85f6613385b677c3b553a30799
yassai_identifier: removed duplicated output in the manual page.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-02-27 11:18:44 +0900
Author date: 2013-02-27 11:18:44 +0900
Commit id: 282637e882f92b733b3bf6f155f904fe5702a352
Systematically load accessory data; convert factors to characters.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-02-26 19:51:05 +0900
Author date: 2013-02-26 19:51:05 +0900
Commit id: 59b6461d172c6d58345c98defb2456e1fac7debb
Uncompressed the data files.
(Some were actually not compressed).
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-02-26 19:04:47 +0900
Author date: 2013-02-26 18:36:36 +0900
Commit id: c9130ebc1a6e53015c8f342d9bd381e03f4feba8
Deleted 'dontrun' instruction.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-02-26 19:04:47 +0900
Author date: 2013-02-26 18:35:38 +0900
Commit id: b8ee044d9034900cc686ac2d4a7ec8117f0cd47c
Replaced '.' by '_' in function names to avoid confusion with S3 dispatches.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-02-26 19:04:47 +0900
Author date: 2013-02-26 17:06:30 +0900
Commit id: 0d6cb9aca3774b97e615428e34c0f3a6006dba46
Renamed functions to replace '.' by '_' and avoid confusion with S3 dispatches.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-02-26 19:04:47 +0900
Author date: 2013-02-26 16:59:55 +0900
Commit id: 7e22515d9e8676aaff8a9bd98fa062b8106829be
Renamed ChangeLog to NEWS.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-02-26 19:04:47 +0900
Author date: 2013-02-26 16:51:46 +0900
Commit id: fe8d8f98117e578ac5342b54edb9a7533f6865cb
Ensured entries are regular expressions.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-02-26 19:04:47 +0900
Author date: 2013-02-26 16:50:08 +0900
Commit id: a080dd9bb390c0c11fef3c4288f4d05f7cc35671
Corrected a typo.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-02-26 19:04:47 +0900
Author date: 2013-01-31 17:57:46 +0900
Commit id: c89cd64950677f13a7c0e9ff4fd3e678ecde279b
Moved installation instructions in a separate page.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-31 15:52:19 +0900
Author date: 2013-01-31 15:52:19 +0900
Commit id: 1a6fcf9f4afa20602333d73386ba3df1c16cd8af
Ignore markdown pages and stylesheets.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-31 15:33:37 +0900
Author date: 2013-01-31 15:33:37 +0900
Commit id: 85f09c908e98fc82135402f8f18b77201625fc46
Merged READMEs.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-31 15:32:28 +0900
Author date: 2013-01-31 15:32:28 +0900
Commit id: c276efdec658cd390cf95e51d1dad9408b5070b3
Symbolic link for ikiwiki only.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-31 15:06:56 +0900
Author date: 2013-01-31 15:06:56 +0900
Commit id: 43b020942234862c7faf6aa9fe2773280dccc97d
Renamed README to comply with Bioconductor.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-31 15:05:23 +0900
Author date: 2013-01-31 15:05:23 +0900
Commit id: 0e945d7a1751661908b94553e537ec30fbd0ccc8
Normalised parameters, using "data=", like in many other R functions.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-31 15:03:40 +0900
Author date: 2013-01-31 15:03:40 +0900
Commit id: e323ec8cd505b1ca9057810a1e9ec656c432d261
Replaced unidentified white character by ASCII space.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-31 14:57:53 +0900
Author date: 2013-01-31 14:57:53 +0900
Commit id: 41d662541c2ab7734f6cee248db723613c65ae98
Do not chose the object called 'clonotypes' by default.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-31 14:57:05 +0900
Author date: 2013-01-31 14:49:11 +0900
Commit id: 10e8717eb6c81c331a2381b93c2a3fe8537de4e9
Merge branch 'master' of git+ssh://osc-lm/osc-fs_home/plessy/git/R/clonotypeR
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 20:38:26 +0900
Author date: 2013-01-08 20:38:26 +0900
Commit id: 48c9fa1f8ab9a7457c7b579c41bded434cd14325
Mention http://clonotyper.branchable.com/
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 20:16:27 +0900
Author date: 2013-01-08 20:16:27 +0900
Commit id: 74925abe92ed7682b56afeb749242aff027def2c
Comment on why the version number starts at 0.99.1.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 20:04:24 +0900
Author date: 2013-01-08 20:04:24 +0900
Commit id: 5fbd8273a36f679032ea615c35b10ecc298aec85
Added biocViews.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 20:00:42 +0900
Author date: 2013-01-08 20:00:42 +0900
Commit id: f304198cf85e7b0546dc4defb68746d03ded0991
Removed file that looks commited by accident.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 19:52:51 +0900
Author date: 2013-01-08 19:52:51 +0900
Commit id: 948e022dcc62643c99a41691e75485dfbca96ae0
Corrected argument name that was too short.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 19:51:51 +0900
Author date: 2013-01-08 19:47:09 +0900
Commit id: 06d1e32a7b6e0fd8bebbc109c9c3caa508599ec0
Notes for the review in Bioconductor.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 19:51:50 +0900
Author date: 2013-01-08 19:43:32 +0900
Commit id: 37298f964077bd147e58052dcf379ff0e5ba73b0
Systematically convert as character, because it is not expensive.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 15:38:30 +0900
Author date: 2012-12-20 21:14:34 +0100
Commit id: dac237885150db368a81e979959011f6f440bfef
Corrected capitalisation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 15:38:30 +0900
Author date: 2012-12-20 11:12:16 +0100
Commit id: 88802f5697838f99b84d74d69617428285d42d68
Also ignore the makefile.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 15:31:20 +0900
Author date: 2013-01-08 15:31:20 +0900
Commit id: d466ad34a6918d42f9fb04c836fd9a6e2dbc2a5b
Explanations about the full source being at git://clonotyper.branchable.com/.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 15:25:06 +0900
Author date: 2013-01-08 15:18:03 +0900
Commit id: 898e169b28fddc6d6fd82536849d18473d58761b
Remove more directories from the Bioconductor package.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 15:25:05 +0900
Author date: 2013-01-08 15:12:21 +0900
Commit id: e93ddb3b48e86a7cdf4353a01ab1721e5bf06dd9
Leaner Bioconductor package, without the wiki documentation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 14:37:36 +0900
Author date: 2013-01-08 14:37:36 +0900
Commit id: 0c2e008f00ee7f7b5e2e1c652fba18c7f00c0ece
Separate .gitignore and .Rbuildignore, to make the Bioconductor package leaner.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 14:34:28 +0900
Author date: 2013-01-08 14:34:28 +0900
Commit id: 45ed4234f5aa4569d871e7320ac310da66285608
Changes forgotten on RIKEN's computer at the end of December.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2013-01-08 14:26:38 +0900
Author date: 2013-01-08 14:26:38 +0900
Commit id: 5edd776656a5f465f834e6ac214a61cc02bf6ee2
Version 0.99.0 according to Bioconductor's guidelines.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-12-16 14:32:05 +0100
Author date: 2012-12-16 14:32:05 +0100
Commit id: 13df713cc992a4882d2e5980d8a39848c7a1039e
Added a one-page vignette pointing at the website.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-12-16 14:26:28 +0100
Author date: 2012-12-16 14:21:21 +0100
Commit id: 5ab860942ffe79aba6baca2b913b4ad6625c7dc1
Removed the function zzz.R supposed to preload support data for yassai.identifier().
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-12-16 12:07:50 +0100
Author date: 2012-12-16 12:07:50 +0100
Commit id: 436a2e1042b9e9ca73abd1fe7d7c24e0ebaf413d
Corrected syntax error in a stop() command.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-12-15 17:23:36 +0100
Author date: 2012-12-15 17:23:36 +0100
Commit id: 9f12d2674c9487be789031053c8a0b0e9b26beeb
Delete accidentally committed swap file.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-12-15 17:10:45 +0100
Author date: 2012-12-15 17:10:45 +0100
Commit id: 3f6bfeae88b74151549842a8c1ae9dc2ef8ea318
Conversion from SRA format (NCBI)
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-12-05 10:23:44 +0000
Author date: 2012-12-05 10:23:44 +0000
Commit id: 7e2b740f7d04e8d104922e3a236b54c3528d4e1e
Replaced another occurence of "Improductive".
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-11-15 23:07:33 +0900
Author date: 2012-11-15 23:07:33 +0900
Commit id: 51de60575e84883082d0b5e148f805d37eae84de
clonotype.table: do not require the presence of score and mapq columns.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-11-15 21:27:02 +0900
Author date: 2012-11-15 21:27:02 +0900
Commit id: fae965441114dca1419418a64c98ea3354c840a4
read.clonotypes: added a scores argument to load legacy data.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-11-15 21:16:59 +0900
Author date: 2012-11-15 21:16:59 +0900
Commit id: 5686598591cfdf104e69930ef06220290f3dbaf0
Renamed yassai.nomenclature yassai.identifier.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-11-14 15:21:30 +0900
Author date: 2012-11-14 15:21:30 +0900
Commit id: ae5da6c7620ffa7058099e44aec177d2be5f2126
yassai.nomenclature: convert vector to data frame and check presence of appropriate names.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-11-14 15:08:50 +0900
Author date: 2012-11-14 15:08:50 +0900
Commit id: 16778f15548db144b84f1d4bb99fccfd2d6650b0
yassai.nomenclature: change default data and parameter name.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-11-14 15:04:54 +0900
Author date: 2012-11-14 15:04:54 +0900
Commit id: 9ebffb23af76ad68628f8ce04737c6bc9ff03980
is_unproductive: new function taken out from read.clonotypes.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-11-14 11:14:03 +0900
Author date: 2012-11-14 11:01:15 +0900
Commit id: a8745080db4508670e2202f1df9e7a57269b6fbc
R script to ensure a proper class for the columns of the clonotypes data frame.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-11-14 10:32:11 +0900
Author date: 2012-11-14 10:32:11 +0900
Commit id: 663089c363eeb2dc6f5ad1ce2906308adb157ee2
rename doc/examples/with__95__test__95__data.mdwn to doc/examples/with_test_data.mdwn
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-11-05 09:58:20 +0000
Author date: 2012-11-05 09:58:20 +0000
Commit id: d40f85b6e358ddb8a827434445d621298314bcae
update for rename of doc/example.mdwn to doc/examples/with__95__test__95__data.mdwn
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-11-05 09:57:25 +0000
Author date: 2012-11-05 09:57:25 +0000
Commit id: ca7e604f9383280b3c7747cba6a61f4156baf51b
rename doc/example.mdwn to doc/examples/with__95__test__95__data.mdwn
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-11-05 09:57:25 +0000
Author date: 2012-11-05 09:57:25 +0000
Commit id: 969aabaf80be8309c49016b20de23818a4594b49
Add a link to the tips.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-11-05 09:05:26 +0000
Author date: 2012-11-05 09:05:26 +0000
Commit id: e3596fde1a53d33d2a918d27a8814e9b7f53645a
Homogenize typography.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-10-10 20:48:36 +0900
Author date: 2012-10-10 20:48:36 +0900
Commit id: 44b92e4fce8bd95671ad4ecf30be21ea0bebc4cf
Link to J_before_FGxG and V_after_C.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-10-10 20:47:07 +0900
Author date: 2012-10-10 20:47:07 +0900
Commit id: a3e8745ba39a0732979afbea7ea0876f16b4e98b
Documented V_after_C and J_before_FGxG.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-10-10 20:44:22 +0900
Author date: 2012-10-10 20:44:22 +0900
Commit id: 6f1ce7e778394062e3f9f5d684bec298fd2b4559
Added an alias for the codon_ids table.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-10-10 20:32:16 +0900
Author date: 2012-10-10 20:32:16 +0900
Commit id: 80a15c8ef6de3a12bd9fd2a978ec74ddc901bc0a
Refreshed HTML documentation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-10-10 20:27:18 +0900
Author date: 2012-10-10 20:27:18 +0900
Commit id: 5e875c51623030840d62a7126c604601a9c1bc18
Renamed html html_doc to avoid a warning.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-10-10 20:00:28 +0900
Author date: 2012-10-10 19:56:56 +0900
Commit id: 3b7f393ee667f93a047558ed9301012beb0d0393
Exclude multi-megabyte example data from the R package.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-10-10 19:38:40 +0900
Author date: 2012-10-10 19:38:40 +0900
Commit id: 4617fab37a16d1a3ed4154b866515d3b5a760616
Added a changelog (GNU-style).
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-10-10 18:56:30 +0900
Author date: 2012-10-10 18:56:30 +0900
Commit id: 702bfc4f59e331c3c9fa797d196dfc969870e856
Corrected Frenglish “improductive” with “unproductive”.
This can break backwards compatibility.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-10-10 18:55:11 +0900
Author date: 2012-10-10 18:55:11 +0900
Commit id: 284902d16b5c040f0d56577642a851b7c408976c
Corrected typo.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-10-10 18:49:15 +0900
Author date: 2012-10-10 18:25:58 +0900
Commit id: 322a12f4bd1a583fa72984439120c2a8d97dcf63
Tip: Reverse-complement and append mate-pair sequence to the first read
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-10-09 11:35:00 +0000
Author date: 2012-10-09 11:35:00 +0000
Commit id: a02891f1fef7e36843b8b049b6d4616b65446302
To do: Report the number of V segments found after `clonotypeR detect`.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-10-09 11:22:11 +0000
Author date: 2012-10-09 11:22:11 +0000
Commit id: f2dcc5971b58d68b95d3279ca70be81c8064c903
Link to source archive in the git repository (branch « release »).
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-09-06 10:38:39 +0000
Author date: 2012-09-06 10:38:39 +0000
Commit id: 06f61655c82aa5261a82c6645d81fde5322904f7
Changed version number (R requires integers), and corrected installation instructions.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-09-06 19:25:48 +0900
Author date: 2012-09-06 19:25:48 +0900
Commit id: a180ec1a79acf71f837dba43e07750e0512d9315
Current version at the time of first submission.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-09-06 19:14:21 +0900
Author date: 2012-09-06 19:14:21 +0900
Commit id: c178971ed2687a8aab4151bbbd79fad0d25551d5
Link to gallery with thumbnails.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-09-06 06:51:35 +0000
Author date: 2012-09-06 06:51:35 +0000
Commit id: fb339a75a2760ddcce0606e5a969a44958260f53
Gallery page.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-09-06 06:45:32 +0000
Author date: 2012-09-06 06:45:32 +0000
Commit id: 48316a2d65dac58420c2240c5e0730933d1fabb4
Corrected name.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-09-06 15:28:43 +0900
Author date: 2012-09-06 15:28:43 +0900
Commit id: e22135b6dc898713766d7881091cffed2a3c7e7b
Thumbnails
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-09-06 15:27:53 +0900
Author date: 2012-09-06 15:27:53 +0900
Commit id: ba6bbfd3b766c4528dc2479e7f415fd07a27c2b7
Example output files from R.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-09-06 15:18:22 +0900
Author date: 2012-09-06 15:18:22 +0900
Commit id: df014b0aed6b1c424c10c1fc441da346ad27edd8
Installation from source.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-09-06 05:45:59 +0000
Author date: 2012-09-06 05:45:59 +0000
Commit id: 0a192aff326956d64578ad40d33fd68cfa4ae2e5
Indicate the name of the unknown libaries.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-09-04 14:36:24 +0900
Author date: 2012-09-04 14:36:24 +0900
Commit id: 5926af361e73ace48ac790e2ff75f6102e54d347
3,653 V–J pairs were detected in SRR407172.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-11 10:44:02 +0000
Author date: 2012-08-11 10:44:02 +0000
Commit id: 9d0226640e2a930a0bc7fb0100cced0837b8c8a8
Suggest pvclust.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-11 17:38:32 +0900
Author date: 2012-08-11 17:38:32 +0900
Commit id: 931fc14f0f83dc5de39a86b7e791032bb324a213
Filter out reads with low mapping quality and alignment scores.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-10 22:13:27 +0900
Author date: 2012-08-10 22:12:13 +0900
Commit id: 6158d7b93dc57d6edd3390c9977a6409ecf510b8
Removed mention of clonotyper convert.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-10 03:50:37 +0000
Author date: 2012-08-10 03:50:37 +0000
Commit id: 464080b5d6c02cdd7c0acd28b9f102ebaf1cd473
Work in /home/ubuntu/clonotyper.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-10 03:50:01 +0000
Author date: 2012-08-10 03:50:01 +0000
Commit id: 6263579ee80b80442b6f5ca0bd3a271489fdb572
Link to /mnt, and added a warning.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-10 03:48:33 +0000
Author date: 2012-08-10 03:48:33 +0000
Commit id: 30ef03fd9863082955e0a5d4bd0753626f3e5c23
Document score and mapq columns.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-10 09:54:06 +0900
Author date: 2012-08-10 09:53:34 +0900
Commit id: 1f461943a713cfa8f9a8b8095a14fb6545c1664d
Users not in the group staff need administrator priviledges.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-09 22:46:44 +0000
Author date: 2012-08-09 22:46:44 +0000
Commit id: 563284305b499452309164cfc0c46ab92eb9ce52
Do not load sequences as factors.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-09 14:54:59 +0900
Author date: 2012-08-09 14:54:59 +0900
Commit id: c4e488154eec177bfa037581369aa95b3325ff7e
Merge branch 'master' of ssh://clonotyper.branchable.com
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-09 14:08:24 +0900
Author date: 2012-08-09 14:08:24 +0900
Commit id: 159b21792b0845462cb13e47e7a0f79364cad990
Suggest vegan.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-09 14:04:47 +0900
Author date: 2012-08-09 14:04:47 +0900
Commit id: d3b4a62dd7cf418ac93f364ca82f6b2dd759a9cf
No need for pandoc in this example. Do not note twice that instance storage is mounted in /mnt. Remove timestamps.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-09 05:04:12 +0000
Author date: 2012-08-09 05:04:12 +0000
Commit id: 4c51296f717e3fa201eb3da71ff61e455d81ad33
Merge branch 'master' of ssh://clonotyper.branchable.com
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-09 13:44:06 +0900
Author date: 2012-08-09 13:44:06 +0900
Commit id: 9727ed496024a33f0851f2a9a8211b53b2f4d1ae
How to build and install the clonotypeR R package from the Git clone.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-09 04:44:46 +0000
Author date: 2012-08-09 04:44:46 +0000
Commit id: 2514e4d01f4326fcf1bf70d3a5161774deb19e7b
Compress the segment sequence files.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-09 13:26:34 +0900
Author date: 2012-08-09 13:26:34 +0900
Commit id: 21ae3c1ccc3f0f51e199a38aea7ea664858d58a8
Segment data for R, and mechanism to refresh it. This needs Bioconducor's Biostrings package.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-09 13:19:41 +0900
Author date: 2012-08-09 13:19:41 +0900
Commit id: 53004ed4a20f35b0859e83483ceefd515de8e6c8
module → package.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-09 13:08:10 +0900
Author date: 2012-08-09 13:08:10 +0900
Commit id: 960b90f5e5a37a62b0da374d39c39410c6d23d2b
Change the mechanism that provides segment data in R, to avoid run-time dependance on Biostrings.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-09 13:02:27 +0900
Author date: 2012-08-09 11:43:55 +0900
Commit id: 3158e88845e3a8b87e75d865e35cd9eb8098974f
Build the R module of *clonotypeR*.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-09 00:10:35 +0000
Author date: 2012-08-09 00:10:35 +0000
Commit id: 32af088c165b4b4c009d7098792b82b998d526c8
Link to instructions to convert FASTQ files, outline of analysis in R.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-08 08:53:03 +0000
Author date: 2012-08-08 08:53:03 +0000
Commit id: 4cdc78d3d250a5427b834fbb6f74ff1b23376ea9
Download and use sff_extract to convert the 454 SFF files.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-08 08:50:09 +0000
Author date: 2012-08-08 08:50:09 +0000
Commit id: ca6915ec03752d8a90f3f6ee296161b62d37225d
sff_extract is now recommended but not required.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-08 08:48:26 +0000
Author date: 2012-08-08 08:48:26 +0000
Commit id: 5950e562b5ce019b71b0b8a6d6901a342567a6ce
How to convert many AB1 files in a single FASTQ file.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-08 07:51:36 +0000
Author date: 2012-08-08 07:51:36 +0000
Commit id: 457214be1be8133574ab98cd362464ed161e5c19
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-08 07:47:12 +0000
Author date: 2012-08-08 07:47:12 +0000
Commit id: d4c17bf9c5f0c90206bc8232f4d3adc99f787f9d
Postpone development of conversion command.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-08 16:03:28 +0900
Author date: 2012-08-08 16:03:28 +0900
Commit id: 27764d3d29a491a2052aa1f195ab714fffca3baf
Merge branch 'master' of ssh://clonotyper.branchable.com
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-08 16:00:50 +0900
Author date: 2012-08-08 16:00:50 +0900
Commit id: 21337966a854f79522db90c29132ef69591481d4
Update manpage.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-08 07:01:31 +0000
Author date: 2012-08-08 07:01:31 +0000
Commit id: e592ed9f63e8047d1a229f7bf98c336556062c70
Remove double quotes, to allow processing more than one file (with no spaces in the name).
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-08 15:57:41 +0900
Author date: 2012-08-08 15:57:41 +0900
Commit id: 7127f9a60d238c7d9d6f30d0ac1b2e7a7f7be958
Postponed the development of a conversion command.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-08 06:49:15 +0000
Author date: 2012-08-08 06:49:15 +0000
Commit id: 92c5e1ecab616956085d515371d9df9ccf80c031
Give up parsing single clonotypes for the moment, and update documentation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-08 15:17:46 +0900
Author date: 2012-08-08 15:17:46 +0900
Commit id: 55819b5e99a2c2a871542295012e1e977caf945a
Updated example to contain alignment scores and mapping qualities.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-08 15:05:07 +0900
Author date: 2012-08-08 15:05:07 +0900
Commit id: 4665683767030eaf441918a0297c9ffd71cb0569
Use standard names for segments that has a counterpart that was removed.
For instance, TRAV7N-5_7D-5 is reverted to TRAV7N-5.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-08 14:52:26 +0900
Author date: 2012-08-08 14:52:26 +0900
Commit id: fe58ce50dd0f301e55d89714e7bb10c9c14cc56b
Convert to character if necessary.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-08 07:42:22 +0900
Author date: 2012-08-08 07:42:22 +0900
Commit id: 2bc1420b180a897dc45d69feff4a1a714f2e3890
Done in commit 7cf11805d84ff8dc6a537c17e73efa275077915d.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-07 11:14:39 +0000
Author date: 2012-08-07 11:14:39 +0000
Commit id: 943dbeb9c433a9d0857e440934ebad63131bfcc3
Created a shortcut for commits.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-07 11:13:20 +0000
Author date: 2012-08-07 11:13:20 +0000
Commit id: b4fb181e9402fadbe60e33064b213996f887ab34
Documentation updates.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-07 20:00:01 +0900
Author date: 2012-08-07 20:00:01 +0900
Commit id: cd8789b3b1ca5eb8b0ff9ca74b873632c834f45a
Accept alignment scores and mapping qualities.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-07 19:53:21 +0900
Author date: 2012-08-07 19:53:21 +0900
Commit id: 3b762f51300af2e5760630f35d01e3842242048d
Corrected and vectorised yassai.nomenclature.R.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-07 19:39:10 +0900
Author date: 2012-08-07 19:39:10 +0900
Commit id: 7cf11805d84ff8dc6a537c17e73efa275077915d
Convert names of V and J segments in yassai.nomenclature().
Closes: 87de09572d8ed59646625d2929b88bce1a3f691b
Closes: yassai.nomenclature_returns_incorrect_values.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-06 21:16:22 +0900
Author date: 2012-08-06 21:16:22 +0900
Commit id: 7484c392a39c5a13e23274dad6c778fbc59ea6d1
Replace hardcoded column names by their name.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-06 21:07:05 +0900
Author date: 2012-08-06 21:06:47 +0900
Commit id: 5b5498fd65be98f69e3954a20a78cbdbd5081d2e
Extract and detect clonotypes from GSE35626.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-05 03:11:40 +0000
Author date: 2012-08-05 03:11:40 +0000
Commit id: 219d9df718d33a5b28b92e43aae5655312931411
Instructions to run from git clone will be completed later.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-05 03:06:29 +0000
Author date: 2012-08-05 03:06:29 +0000
Commit id: 2d724f12fda97d167bb5894d3c783d5d64dfb606
Added back pseudogenes, polished alignment, rebuilt derived files.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-05 12:05:14 +0900
Author date: 2012-08-05 12:04:16 +0900
Commit id: 7e84f7c766a4eb429a9e731cbe89198a50925d40
Added back TRAV6D-6 and TRAV6N-6 as they are unique, explain about removals.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-05 12:05:14 +0900
Author date: 2012-08-05 09:32:45 +0900
Commit id: cb88320627458f0e54be47dbd80dfec20ad91754
Install clonotyper from source in /mnt.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-04 23:49:26 +0000
Author date: 2012-08-04 23:49:26 +0000
Commit id: 84a978afa19dcdaee718474e5384988b5d0f21be
Inserted a table of contents.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-04 13:09:17 +0000
Author date: 2012-08-04 13:09:17 +0000
Commit id: 46312bacdbebe13f8ef9e73fec5066a08f42bb8b
Convert from SRA to FASTQ format with the SRA Toolkit.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-04 13:06:56 +0000
Author date: 2012-08-04 13:06:56 +0000
Commit id: d775e894f2447be67b010d3fe3691d7e988afd8e
Record all mapping qualities and alignment scores instead of discarding low ones.
The scores are temporarly embedded in the read names. The filtering will take
place in R with the function "clonotype.table".
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-04 21:54:36 +0900
Author date: 2012-08-04 21:54:36 +0900
Commit id: 6ee0d196cac21307a36bdf41c896cb33d2d62b9e
Pass CLONOTYPER_REFERENCE to VJsplit.
VJsplit and clonotypeR should rather be merged.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-04 21:51:10 +0900
Author date: 2012-08-04 21:51:10 +0900
Commit id: c6967a6fdea7d9f270fd3814a407ffa0f727478f
Do not set CLONOTYPER_REFERENCE in VJsplit if absent.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-04 21:50:39 +0900
Author date: 2012-08-04 20:51:26 +0900
Commit id: 49370c4b6ef91b1397c7ab0b9701965ea6ef33dd
Really count the number of V segments detected.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-04 12:07:17 +0000
Author date: 2012-08-04 12:07:17 +0000
Commit id: 30a6c55210e2c095adb32337064e4aebd601bf8b
Look for scripts and reference alignments in fixed locations where no path is provided.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-04 20:48:49 +0900
Author date: 2012-08-04 20:48:49 +0900
Commit id: cdb630e18dfa3c9edef57f9205773c00a1235366
create a directory for analysis in /mnt, where the instance storage is mounted.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-04 11:46:17 +0000
Author date: 2012-08-04 11:46:17 +0000
Commit id: 7f5722071879eedf1427bcf3d7145ff8c58debb9
Startyed example analysis using the GSE35626 public dataset.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-04 09:35:55 +0000
Author date: 2012-08-04 09:35:55 +0000
Commit id: 659686f92e6b0b22ea3fb9188ae8da67f752b6b4
Example analysis using the GSE35626 public dataset.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-04 09:18:17 +0000
Author date: 2012-08-04 09:18:17 +0000
Commit id: 0ac53483220ff1153b67e6d1a2aa3e2ced726384
Link to the example with the GSE35626 dataset.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-08-04 09:15:57 +0000
Author date: 2012-08-04 09:15:57 +0000
Commit id: f2a41806b5e2f25113b788508d2c3b8a37909a3c
Document what common_clonotypes does on a single group of samples.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-03 18:18:54 +0900
Author date: 2012-08-03 18:18:54 +0900
Commit id: 32f81615ac4de2c7240c2f7058d3a8689845343d
Typo.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-03 15:34:00 +0900
Author date: 2012-08-03 15:34:00 +0900
Commit id: 8e4caeb05e7a4a628c21c6b9338528c68fdea50a
Refreshed R documentation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-03 15:27:31 +0900
Author date: 2012-08-03 15:27:31 +0900
Commit id: ccbeb8f84a147c49e883d83b93e7c2293585ac5f
Example on how to count clonotypes common to two groups of libraries.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-03 15:26:41 +0900
Author date: 2012-08-03 15:26:41 +0900
Commit id: deec7882c6975b93c6f3bc663031e2c60f8a3dd5
Use all libraries of the clonotypes data frame by default.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-02 11:02:39 +0900
Author date: 2012-08-02 11:02:39 +0900
Commit id: 4ce04656c3321fa05d1956ff484d85ea3259d2af
Specify the field separator.
This allows empty 'peptide' values, when the CDR3 is shorter than 3 bases.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-01 16:06:31 +0900
Author date: 2012-08-01 16:06:31 +0900
Commit id: 2253562b4dd5303c5da536c1bd29c0653e8fdb79
Skip header only for OSCTable files (TSV files do not have).
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-01 16:01:14 +0900
Author date: 2012-08-01 16:01:14 +0900
Commit id: 8fbcb6e1093b65a1ed476ef94915f817320b8145
Ignore nonexistent files.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-01 12:48:19 +0900
Author date: 2012-08-01 12:48:19 +0900
Commit id: 5bd8c70d573dfc79bdf67d13a296a2b9f2ec3576
Honor TMPDIR.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-01 11:50:22 +0900
Author date: 2012-08-01 11:50:22 +0900
Commit id: 8973ddc350becf57220e31efc63035762fa17b0a
Use the correct directory for cleaning the clonotype file.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-01 11:42:35 +0900
Author date: 2012-08-01 11:42:35 +0900
Commit id: 647aa419a5332b49b64f9d6e919f15d0007abc4e
Added a DEBUG option, and reduce the number of temporary files when not using it.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-01 11:37:48 +0900
Author date: 2012-08-01 11:37:48 +0900
Commit id: ef1efab3236e2080e4df5e635a4933dbbb31f9ef
Transfer a comment to the tips page.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-08-01 11:17:04 +0900
Author date: 2012-08-01 11:17:04 +0900
Commit id: 423cf824e3b9788c732c488440d3204949bcfa48
Extend common_clonotypes with a matrix mode.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-25 19:50:15 +0900
Author date: 2012-07-25 19:50:15 +0900
Commit id: f1bfc0d7c8eef54f18898057fdf812b7d4d8acc4
Reorganised the clonotype page, giving an example ane clarifying that the C and FGxG motif are not included.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-25 05:11:12 +0000
Author date: 2012-07-25 05:11:12 +0000
Commit id: 828365468658f5307b6dd08ccbc553cd438490f3
Link to the reference directory's README page.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-25 04:49:01 +0000
Author date: 2012-07-25 04:49:01 +0000
Commit id: b41c10020484c0bf65611f96bfab3ecd7b5bab4a
Polish the reference directory's README.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-25 13:45:43 +0900
Author date: 2012-07-25 13:45:43 +0900
Commit id: db8aff192824b7e5c0d9c4770c97c9ee7c0c828c
Removes dependance on moreutils by replacing the call to sponge.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-25 13:30:28 +0900
Author date: 2012-07-25 13:30:28 +0900
Commit id: e03a112b7e446ecb39ced21d74945f72b110d2e3
Moved FASTQ conversion instructions to the clonotypeR script.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-25 11:49:40 +0900
Author date: 2012-07-25 11:49:40 +0900
Commit id: 91bf372202d1437a8486acc7593bc4323a7ed617
Introduce clonotypes.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-24 12:45:31 +0000
Author date: 2012-07-24 12:45:31 +0000
Commit id: 00051fe58e0eeb6f149e0ce2d5f5a7cf6756a1b5
Link to clonotype page.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-24 12:40:59 +0000
Author date: 2012-07-24 12:40:59 +0000
Commit id: fbbd3166a535af18b0c5782f8918bc963ebc411c
Background to underline code and examples.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-24 21:24:35 +0900
Author date: 2012-07-24 21:24:35 +0900
Commit id: 04f0d2e87b2faf19bc940363b17d5785103c8630
Merge branch 'master' of ssh://clonotyper.branchable.com
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-24 21:02:15 +0900
Author date: 2012-07-24 21:02:15 +0900
Commit id: 380e1089011f44655d168fca132494d4c007e857
Data exploration in R.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-24 11:56:38 +0000
Author date: 2012-07-24 11:56:38 +0000
Commit id: 41c326181660ea9ca29a22ad42117e41102e6dc9
List Biostrings in the requirements.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-24 11:21:24 +0000
Author date: 2012-07-24 11:21:24 +0000
Commit id: aee84935a807a53ebb2347a37858cba816398673
Convenience target to build the R module.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-24 20:16:14 +0900
Author date: 2012-07-24 20:16:14 +0900
Commit id: 9a113329a4116a5bb16531a153ae01f254d4f70f
Ignore Git and Ikiwiki directories when building the R module.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-24 20:15:37 +0900
Author date: 2012-07-24 20:15:37 +0900
Commit id: 34a33012d0878dfcb4de8691171ecb9387fbc58c
Convenience target to call R CMD check.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-24 20:13:22 +0900
Author date: 2012-07-24 20:13:22 +0900
Commit id: 50dc075faad81c82b2a0d00f00a96bf54c722ffc
Stop on error.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-24 20:05:16 +0900
Author date: 2012-07-24 20:05:16 +0900
Commit id: 8109542596b9b1982495f023c769616bc94cb385
Default location for reference files, create clonotype directory if it does not exist.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-24 20:03:14 +0900
Author date: 2012-07-24 20:03:14 +0900
Commit id: bd429351a7e929b0b8efd87d0002d602d3306c1f
Miniaturise whole page header.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-24 19:03:05 +0900
Author date: 2012-07-24 19:03:05 +0900
Commit id: 49d8d5a5071ff575ca9916954a89ffaef199d100
Make the branchable action bar less visible.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-24 18:52:29 +0900
Author date: 2012-07-24 18:52:29 +0900
Commit id: fff2a99b1788ea2215284852c4137a263155df09
Removed subtitle.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-24 09:37:46 +0000
Author date: 2012-07-24 09:37:46 +0000
Commit id: 1762c0cda5668924b405fc324ed8f685c0a5b0d5
Mention alternative works.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-24 09:35:15 +0000
Author date: 2012-07-24 09:35:15 +0000
Commit id: 80b51287b661c50293f22c2341ffa0f87290dc23
Create directories if they do not already exist.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-24 09:28:28 +0000
Author date: 2012-07-24 09:28:28 +0000
Commit id: afab0c906ef95097fe5cf41669e07d3685a64fd6
Create $EXTRACT_DIR instead of stopping with an error if it is absent.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-24 18:25:21 +0900
Author date: 2012-07-24 18:25:21 +0900
Commit id: 8c13182f552c00c4dcd808c0317e9135dcb115e3
Transfer instructions from README to doc.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-23 21:55:04 +0900
Author date: 2012-07-23 21:55:04 +0900
Commit id: ecf7151fa47931e4bf6df118606c2762404d8181
Example analysis.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-23 21:48:48 +0900
Author date: 2012-07-23 21:48:48 +0900
Commit id: 110e5fc8c8a102b59dde301df45f27ed54d620c1
Link to example and manual page.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-23 21:47:35 +0900
Author date: 2012-07-23 21:45:31 +0900
Commit id: 62309082cc3d5f2d6cdff29d8a5b3b03d84ff6cf
Draft manual page.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-23 21:40:57 +0900
Author date: 2012-07-23 21:37:56 +0900
Commit id: 72edf13c5416d873a716a82ab0156c68db4cea2c
VJsplit: do not output the sequence passed to vectorstrip.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-23 21:35:18 +0900
Author date: 2012-07-23 21:35:18 +0900
Commit id: ff0a39ea2a4082ec0bbf0ab107556a50f300de80
Turn off verbosity by default.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-23 20:21:59 +0900
Author date: 2012-07-23 20:19:43 +0900
Commit id: b824c1f1d358f3a4c6095a63320a7417d03485b6
Test if $EXTRACT_DIR is present.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-23 20:21:57 +0900
Author date: 2012-07-23 20:19:18 +0900
Commit id: 657b84a11f9d67e9bb0400241c32ea353488b189
Point default paths to /etc and /usr/share.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-23 19:40:24 +0900
Author date: 2012-07-23 19:40:24 +0900
Commit id: ba7a6d27bf0f5e5c8115742da00679a45beb7745
Moving general documentation to a 'doc' folder.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-23 18:34:09 +0900
Author date: 2012-07-23 18:34:09 +0900
Commit id: 21e5820be3d6e8b5844161c4f93ea22bb22c920b
Moving general documentation to a 'doc' folder.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-23 18:33:25 +0900
Author date: 2012-07-23 18:33:25 +0900
Commit id: 1624e36c0995d729b6526f66c1e0dfee7c0bba5c
Example data from three 454 runs.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-20 18:30:22 +0900
Author date: 2012-07-20 18:30:22 +0900
Commit id: a6a6aa2d98c1af16420d4d2ef17a67992a93524f
More cosmetic typographical changes.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-20 09:18:43 +0000
Author date: 2012-07-20 09:18:43 +0000
Commit id: 7cf7386f69467833e72cbc53df74d14f4393f67b
Drafted workflow.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-20 08:28:18 +0000
Author date: 2012-07-20 08:28:18 +0000
Commit id: 234b4da7afa24f12c2df65f1ac1b25dd9251385b
Cosmetic typographical changes.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-20 06:58:15 +0000
Author date: 2012-07-20 06:58:15 +0000
Commit id: d3911ac5fa37787e9c9d0f667f00eac037e3930e
Link to create the workflow page.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-20 06:45:40 +0000
Author date: 2012-07-20 06:45:40 +0000
Commit id: 5a3447d6ab8baa1fd804321f17f3cff4762ff3b7
Ignore for R what Git ignores.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-20 13:46:04 +0900
Author date: 2012-07-20 13:46:04 +0900
Commit id: a3da418ec4034eec9248773155714f5d5121d7d8
Link R documentation to home page.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-20 13:39:40 +0900
Author date: 2012-07-20 13:39:40 +0900
Commit id: 0cebb909093538b3f27461fd442f1ee137781e4d
HTML documentation of the R package.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-20 13:05:44 +0900
Author date: 2012-07-20 13:05:44 +0900
Commit id: 9b3268609cb0d81b8a996d3903bc7f155a8825e1
Build the HTML documentation of the R package.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-20 13:04:57 +0900
Author date: 2012-07-20 13:04:57 +0900
Commit id: a112ecba087d380914f37d7a881cebe7fd42b717
Uppercase Bugs.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-19 19:49:46 +0900
Author date: 2012-07-19 19:49:46 +0900
Commit id: 015ea4901bf9f91ee8342bc063fb83e326c52c11
Moved the page for resolved bugs to the upper-case directory.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-19 19:44:37 +0900
Author date: 2012-07-19 19:44:37 +0900
Commit id: 9b9777f64fc6232d2897453a8175f317de208123
Removed `feedpages="created_after(bugs/no_commit_mails_for_new_pages)"`
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-19 01:49:46 +0000
Author date: 2012-07-19 01:49:46 +0000
Commit id: 87de09572d8ed59646625d2929b88bce1a3f691b
yassai.nomenclature returns incorrect values.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-19 01:48:07 +0000
Author date: 2012-07-19 01:48:07 +0000
Commit id: 457946564a564fc619af23d8ea1287dc4aea4979
Copied from ikiwiki's bugs page.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-19 01:45:21 +0000
Author date: 2012-07-19 01:45:21 +0000
Commit id: 3fdb95c79d1a2062bedcb66918c00ea5879e9c95
Copied from ikiwiki's bugs page.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-19 01:44:23 +0000
Author date: 2012-07-19 01:44:23 +0000
Commit id: 8c26833a69d608a2dd191b887206ecd6fa3d2e78
Added a link to the source code.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-19 01:38:04 +0000
Author date: 2012-07-19 01:38:04 +0000
Commit id: 894c2fd99fdf889525daaca025f3f1b7f7f24ddd
TODO: Support extraction of barcoded reads.
Committed by: admin
Author Name: http://plessy-riken-jp.myopenid.com/
Commit date: 2012-07-19 01:35:50 +0000
Author date: 2012-07-19 01:35:50 +0000
Commit id: 5ccaae9f37ed68069917a74357e703ae252aa57f
Committed by: admin
Author Name: https://www.google.com/accounts/o8/id?id=AItOawnBeKsGItVOjWWGrYqYJDfn0hacxUHE0R4
Commit date: 2012-07-19 01:18:50 +0000
Author date: 2012-07-19 01:18:50 +0000
Commit id: 0b2a08f02fb74a1fce64539906660a0b29274c0f
Committed by: admin
Author Name: https://www.google.com/accounts/o8/id?id=AItOawnBeKsGItVOjWWGrYqYJDfn0hacxUHE0R4
Commit date: 2012-07-19 01:12:48 +0000
Author date: 2012-07-19 01:12:48 +0000
Commit id: 23c7f53c15a984ab80ed6b911bef69cc07721b7a
Corrected a typo.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-18 20:27:22 +0900
Author date: 2012-07-18 20:27:22 +0900
Commit id: dbcf051f8fc0345f298ae348e378f302103bab5b
Place clonotypeR in the public domain.
See: http://creativecommons.org/publicdomain/zero/1.0/
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-18 20:22:42 +0900
Author date: 2012-07-18 20:22:42 +0900
Commit id: 17c160a4224ae3d8f011d8b177a4f70b8e886c83
Index page.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-18 20:10:22 +0900
Author date: 2012-07-18 20:10:22 +0900
Commit id: 44b75a4381e6790186985666f33a10edcaed79ff
Merge branch 'master' of git+ssh://osc-lm/osc-fs_home/plessy/git/clonotypeR
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-18 20:08:24 +0900
Author date: 2012-07-18 20:08:24 +0900
Commit id: fda34793a1a8e8fa5a298e34ec3ac6f6bd04cf6b
Merge /home/plessy/git/clonotypeR
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-18 17:53:48 +0900
Author date: 2012-07-18 17:53:48 +0900
Commit id: 77799de49185890c7ae050b148795f14dcba25ad
initial commit
Committed by: admin
Author Name: admin
Commit date: 2012-07-18 03:56:07 +0000
Author date: 2012-07-18 03:56:07 +0000
Commit id: c3c98e1f1873691a926b21a6c3a193db0691c7b5
Attempt to load codon_ids if not found.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-17 19:36:16 +0900
Author date: 2012-07-17 19:36:16 +0900
Commit id: 65c20abd543e971a49c416c60d7eeeba9a847575
Workaround that actually does not work in the regression tests.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-17 18:56:24 +0900
Author date: 2012-07-17 18:56:24 +0900
Commit id: e2028c44097db1e04b1156c44281637d61bea985
Superseded by data/J_before_FGxG.R and data/V_after_C.R.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-17 18:10:36 +0900
Author date: 2012-07-17 18:10:36 +0900
Commit id: 2eba0f44b76672fb06c050a984bc72ed89496028
Corrected typo in J_before_FGxG.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-07-17 18:04:22 +0900
Author date: 2012-07-17 18:04:22 +0900
Commit id: b8aa6fb7436d6cda6197df5ef62faa5efba05d8a
Corrects a stupid bug. Never write programs in a rush before eating ! Always make tests !
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-14 13:39:25 +0900
Author date: 2012-06-14 13:39:25 +0900
Commit id: 289ca1b13c02db17eed38e00aae33429bd41f1e9
Depends: Biostrings.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-14 11:54:30 +0900
Author date: 2012-06-14 11:54:30 +0900
Commit id: 8e3d4fb21ee98811f064ddf1b9e3a14efa366ad9
Pre-load V_after_C" and "J_before_FGxG". Is that necessary ?
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-14 11:53:45 +0900
Author date: 2012-06-14 11:53:45 +0900
Commit id: 61cb7edfb7a54201319df952155b29f2ccbe181b
Link to common_clonotypes.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-14 11:53:28 +0900
Author date: 2012-06-14 11:53:28 +0900
Commit id: a54d69501aa48c80c1d644290563d93dc92776be
common_clonotypes: lists clonotypes common to two groups of samples.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-14 11:49:17 +0900
Author date: 2012-06-14 11:49:17 +0900
Commit id: d6ea4990313a6f222aa2e2ccc840f669180d9b63
Renamed to avoid confusion with generic functions.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-14 11:33:46 +0900
Author date: 2012-06-14 11:33:46 +0900
Commit id: 8dbbc4359b47c8f80da2d3d264b671a76484433c
Load V_after_C and J_before_FGxG file for calculating Yassai's nomenclature.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-12 21:28:35 +0900
Author date: 2012-06-12 21:27:57 +0900
Commit id: 9ca756a7a87dd5fc592783387de6ff2fa82ecdcb
Compressed so that they are found in the same path in the Git repository and the installed R library.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-12 21:07:32 +0900
Author date: 2012-06-12 21:07:32 +0900
Commit id: af1286faff89813f5f853eef96d661350b1cd603
Proofread documentation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-12 20:53:36 +0900
Author date: 2012-06-12 20:53:36 +0900
Commit id: d350a525f229bab443615e2847be97f9145846df
Renamed to avoid confusion with generic functions.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-12 20:44:15 +0900
Author date: 2012-06-12 20:44:15 +0900
Commit id: 4fc5bb4c2cc97fd7e55e320c3352e479f54d2284
Corrected code/documentation mismatches.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-11 19:01:46 +0900
Author date: 2012-06-11 19:01:46 +0900
Commit id: 3c39536ca0f8921293929342f1c9785786285e48
Document filters option of clonotype.table.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-11 18:52:32 +0900
Author date: 2012-06-11 18:52:32 +0900
Commit id: 7da963bd688f19f13c350759e59ae75590a0783b
Corrections for empty entries.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-11 18:41:20 +0900
Author date: 2012-06-11 18:41:20 +0900
Commit id: 842cbf83f24ddfdc01e38a2904967cb1c667e0cb
Corrected data name.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-11 18:35:36 +0900
Author date: 2012-06-11 18:35:36 +0900
Commit id: 3e48079cc0d3f747232d6d1ab4dcde79f3fa1e3b
Renamed codon_ids.table.txt to match man/data-codon_ids.Rd.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-11 17:00:19 +0900
Author date: 2012-06-11 17:00:19 +0900
Commit id: 601a7072a32d20e8d3eb5f2ecbf5c2c92c1786f7
ASCII quotes to simplify encoding.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-06-11 16:56:33 +0900
Author date: 2012-06-11 16:56:33 +0900
Commit id: fe9d1e38804a7ac7c52c3bac3a19518fa8acc840
Correct documentation links.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-05-16 16:47:44 +0900
Author date: 2012-05-16 16:47:44 +0900
Commit id: 53b4aa6893a7f1e609fe7c26be703c34ee6ca354
Corrected documentaion example.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-05-16 16:26:40 +0900
Author date: 2012-05-16 16:26:40 +0900
Commit id: ced03a73c0cc4becd4285ff4b673fd8e8b7274d9
Use the provided clonotype table instead of the previously hardcoded one.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-05-16 16:24:53 +0900
Author date: 2012-05-16 16:24:53 +0900
Commit id: 00aed02d14797f986f23c15cf269d4a752f33704
Exit with error if filename is an empty string.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-05-16 16:18:18 +0900
Author date: 2012-05-16 16:18:18 +0900
Commit id: f120a81e0fd88beb3d4c408db9841c3a3c0cb9b8
Dedicate to public domain (to be confirmed by public release).
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-05-16 16:05:15 +0900
Author date: 2012-05-16 16:05:15 +0900
Commit id: 73621a30be2c8c23a10fafb2ec19979851106b75
Corrected markup syntax errors.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-05-16 15:47:51 +0900
Author date: 2012-05-16 15:47:51 +0900
Commit id: 00ac560dbc024b2e958367e3ce5805df40193767
Correction of how to load example data.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-04-24 20:44:21 +0900
Author date: 2012-04-24 20:44:21 +0900
Commit id: 8afb7daf712b6af1c787aa69fa66d17f0b7b028f
Syntax correction.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-04-24 20:41:34 +0900
Author date: 2012-04-24 20:41:34 +0900
Commit id: c1913a3da561be08528be6372365343a6c0a6efe
Syntax corrections.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-04-24 20:18:33 +0900
Author date: 2012-04-24 20:18:33 +0900
Commit id: 99c3c73fea6e5cb8b4eea47dfb021bb729339b8a
Do more regression tests.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-04-24 20:18:00 +0900
Author date: 2012-04-24 20:18:00 +0900
Commit id: 357f8c5faa6d4ac7c6ebe3c60ee2e0f5f68930dd
Abort if no "improductive" column is found.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-04-24 20:17:27 +0900
Author date: 2012-04-24 20:17:27 +0900
Commit id: 105b91829fec2ead2a6988b8e845e7fa9732142a
Corrected to also accept the OSCT format.
Order Switchable Column Table (OSCT): http://sourceforge.net/projects/osctf/
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-04-05 21:15:17 +0900
Author date: 2012-04-05 21:15:17 +0900
Commit id: 85c55309a1a390a84dc7c9b57e304e62ef869502
Closes example section.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-03-30 19:40:56 +0900
Author date: 2012-03-30 19:40:56 +0900
Commit id: 743444726e12ea782c6ca3d018bb3f324b138f14
Re-indexed using BWA 0.6.1-r104.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-03-28 15:41:31 +0900
Author date: 2012-03-28 15:41:31 +0900
Commit id: c2fc8bfd29f3d2819734c57db907a62cf19e173d
Default directories for extraction.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-03-14 20:09:45 +0900
Author date: 2012-03-14 20:09:45 +0900
Commit id: bfbc7d135702a3f59ac8ac53c5b5047f6f71de08
Tweaks to allow exection from any directory.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-03-01 19:27:53 +0900
Author date: 2012-03-01 19:27:53 +0900
Commit id: acf2ca9cae299fed66c4175785f00cbe6eb1a59e
clontyperR {convert|detect|extract}
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-03-01 15:12:18 +0900
Author date: 2012-03-01 15:12:18 +0900
Commit id: dbd6825403c669a58f8ddfff892d404a35c1d955
Removed suffix.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-03-01 15:03:56 +0900
Author date: 2012-03-01 15:03:56 +0900
Commit id: 86929836cbbc33a4a28451aa7fcf0b7786117886
Added a “clean” target.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-03-01 14:56:08 +0900
Author date: 2012-03-01 14:56:08 +0900
Commit id: 32f65255e3b94257c273bfb956e81d8f0e37a60d
Polishing.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-02-08 17:56:39 +0900
Author date: 2012-02-08 17:56:39 +0900
Commit id: 014a9447214b8f40f53b5352b9f9a55dfcd6e02f
Polishing documentation.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-02-08 16:38:28 +0900
Author date: 2012-02-08 16:38:28 +0900
Commit id: 6a7b0d1672f7c0f5541c51edee914434e52bf3b0
Typography.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-02-08 16:06:23 +0900
Author date: 2012-02-08 16:06:23 +0900
Commit id: 2d1373fc10063873145b5c5f0f3ee27905bf9d6f
Added a “all” target.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-02-08 15:46:09 +0900
Author date: 2012-02-08 15:46:09 +0900
Commit id: 0e4a5040ec2a720a9f40e947decb37b39a1a6288
Need more example data.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-02-08 15:45:35 +0900
Author date: 2012-02-08 15:45:35 +0900
Commit id: 446bc0f82175623f9757384e7b08478b3813b3da
Added URL to BioPerl.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-02-08 15:38:19 +0900
Author date: 2012-02-08 15:38:19 +0900
Commit id: d063e96963be169fa08c864ae34f0e28048b4ee6
Rough implementation with codon IDs. Needs triplechecking.
V and J segment names need to be corrected.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-01-31 21:50:46 +0900
Author date: 2012-01-31 21:50:46 +0900
Commit id: 54db3f0b0b5aa0cf85bdecc1510c42e81c5ba5cc
Documented what the code is doing.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-01-31 20:59:16 +0900
Author date: 2012-01-31 20:59:16 +0900
Commit id: b146a6e49da766c2e1e12cde68e7d5ea7b2f0b24
Attempt at pre-loading J_before_FGxG and V_after_C.
This will probably not work du permier coup.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-01-31 20:49:31 +0900
Author date: 2012-01-31 20:49:31 +0900
Commit id: 33f349b81daf0a93522947ec322817870cdbe495
Replace NA per FALSE; is.somatic is used in a while loop.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-01-30 22:03:28 +0900
Author date: 2012-01-30 22:03:28 +0900
Commit id: aea439fafba06808caa7e4c63e52a9aaf88c2dbe
First step to implement Yassai's nomenclature: the CDR3.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-01-30 21:27:56 +0900
Author date: 2012-01-30 21:27:56 +0900
Commit id: bca53f58171a8531527c27ba95dce30ec612d9bf
Added codon ID table for the Yassai nomenclature.
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC2706371/table/Tab1/
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2012-01-30 16:12:14 +0900
Author date: 2012-01-30 16:12:14 +0900
Commit id: b4719e4cb8ec41af182655dfcbfdbefd6168b63d
Preparing the use of the OSCTable format.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-12-08 13:16:07 +0900
Author date: 2011-12-08 13:16:07 +0900
Commit id: efd107dea8443a28cc323499ad8817a3930168ae
Draft instructions and script to extract clonotypes.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-11-17 16:03:45 +0900
Author date: 2011-11-17 16:03:45 +0900
Commit id: 9d7dbca10624f2c17aeecd66c27012ef786f133d
Standardised options, shortened error messages, added one check.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-11-16 20:20:20 +0900
Author date: 2011-11-16 19:33:21 +0900
Commit id: c550e00f807a29c1289df2c295315696f127a880
Reordered options in clonotype.table, and corrected for single libraries.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-11-16 18:50:18 +0900
Author date: 2011-11-16 18:50:18 +0900
Commit id: df93f52d317c28460043b0eb3e3dc58c369c843b
A function to list unique clonotypes.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-11-14 16:36:16 +0900
Author date: 2011-11-14 16:36:16 +0900
Commit id: fac03e7856569142cda91dc03634ba8e25f006ad
New function to prepare clonotype tables.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-11-08 22:09:24 +0900
Author date: 2011-11-08 22:09:24 +0900
Commit id: eaf026e1561dffb78d2de39fc512c43464d966f9
Test data using three libraries.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-11-08 22:08:24 +0900
Author date: 2011-11-08 22:08:24 +0900
Commit id: c9ba9d9961824143a0377da909715ec84a5ab71c
Integrate the calculation of the eight column: improductive rearrangements.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-11-08 21:26:40 +0900
Author date: 2011-11-08 21:26:40 +0900
Commit id: d51893483065123767653044ff73a714d10aa685
Function “read.clonotypes” to load a clonotypes file, and example data.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-11-04 22:17:34 +0900
Author date: 2011-11-04 22:06:06 +0900
Commit id: adb605e8a90ec5639d854a91e994a57a5684e794
BWA index of trimmed V segments.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-10-31 14:47:00 +0900
Author date: 2011-10-31 14:47:00 +0900
Commit id: 30576e3dc2856f96a67a7dc5226df8a2a0810824
Reference V and J segments trimmed at C or FGxG motifs.
Needed for V-J extraction by the “VJsplit” script.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-10-31 14:27:37 +0900
Author date: 2011-10-31 14:27:37 +0900
Commit id: 8c2f82eda0e73ad7f4f77bebc72e5cea04c3a9d3
Reference V and J alignment (made by hand using SeaView).
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-10-31 14:27:16 +0900
Author date: 2011-10-31 14:24:21 +0900
Commit id: 700b879cd76980cf45ab9dfdfdfc242551608fc7
Extraction of the V, (D), J and C segments from the reference sequences.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-10-31 14:23:42 +0900
Author date: 2011-10-31 14:05:23 +0900
Commit id: 1363b60e26074401ff9cf1f2b62e2ecd44217ac1
Added reference TCR genes from RefSeq, but BCRs and update helper are needed.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-10-31 12:13:35 +0900
Author date: 2011-10-31 12:13:35 +0900
Commit id: dc77dc1264965d79f786f355f1e91e987132de3d
Initial empty master branch.
Committed by: Charles Plessy
Author Name: Charles Plessy
Commit date: 2011-10-31 12:13:00 +0900
Author date: 2011-10-31 12:13:00 +0900
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@94506 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/Bugs.mdwn b/Bugs.mdwn
new file mode 100644
index 0000000..1106591
--- /dev/null
+++ b/Bugs.mdwn
@@ -0,0 +1,12 @@
+If you've found a bug in clonotypeR, post about it here. [[TODO]] items go
+elsewhere. Link items to [[Bugs/done]] when done.
+
+The [[!shortcut name=commit url="http://source.clonotyper.branchable.com/?p=source.git;a=commitdiff;h=%s"]].
+You can use it to link to the commit that fixed the bug, as in `\[[!commit 7cf11805d84ff8dc6a537c17e73efa275077915d]]`.
+
+There are [[!pagecount pages="Bugs/* and !Bugs/done and !Bugs/discussion and
+!link(patch) and !link(Bugs/done) and !Bugs/*/*"]] "open" bugs:
+
+[[!inline pages="Bugs/* and !Bugs/done and !Bugs/discussion and
+!link(patch) and !link(Bugs/done) and !Bugs/*/*"
+actions=yes rootpage="Bugs" postformtext="Add a new bug titled:" show=0]]
diff --git a/Bugs/Clonotype_that_takes_ages_for_calculating_the_Yassai_identifier..mdwn b/Bugs/Clonotype_that_takes_ages_for_calculating_the_Yassai_identifier..mdwn
new file mode 100644
index 0000000..7cdfc91
--- /dev/null
+++ b/Bugs/Clonotype_that_takes_ages_for_calculating_the_Yassai_identifier..mdwn
@@ -0,0 +1,55 @@
+Problem
+-------
+
+<pre>
+yassai_identifier(c(V="TRAV14N-3", J="TRAJ16", dna="GCAACTTCAAGTGGCCAGAAGCTGGTT", pep="ATSSGQKLV"))
+# takes ages
+
+yassai_identifier(c(V="TRAV14N-3", J="TRAJ16", dna="GCAGCAACCGCAACTTCAAGTGGCCAGAAGCTGGTT", pep="AATATSSGQKLV"))
+## [1] "aTa.2A14N3A16L12"
+# returns immediately.
+</pre>
+
+
+Troubleshooting
+---------------
+
+The problematic clonotype comes from read `GWYEMNS10GHZUF`.
+
+<pre>
+@GWYEMNS10GHZUF
+gactAACTGGTACACAGCAGGTTCTGGGTTCTGGATGTGCAGGTACACCTTTAATATGGTCCCCTGGCCAAAAACCAGCTTCTGGCCACTTGAAGTTGCACAGAAGTAGGTGGCTGAGTCTCCAGGCTGAGAGTCTTTGATGTGCAAGGAGAGATTTTTCTCCCTTTTATTGAAGAAGATTGTGAATCGTCCATCTTCCTTTTTATCGGACACTGAACGTATGGCTATCAGGAGAGCAGGGCCTTCCCCAGGGAACTGCTGGTACCATGGGAAGTAGTCAAAAGCACTGTTCTCAtaactagcagttcagaattgcggtctctccttccccagactgtcagagattggagtcgtgggagacaaggcacacaggggataggngngnnnnnnnnnnnnn
++
+FFF::;;FFFFFFFFIIIIHFFFHF666=<FFGGDDDFFHFDIIIIIIIHHHIIIHFFFD54449662200001335>>AAABDFDDDFDDDFFFFFFFFFFFFFFFFFCCCCCFFFFFFFFFFFFDDBBBBB==110?@@@@@>4455BBA??3357;F4:::;;==D88?AA<;:==BAAAA==??AAB@AAA=>>>222//02A8898BDDFFFDDFFFFFF666:DBAAAABB:::???DD;;;;D?????DDBA?<<<><<<<000444<8993222233393...:663322<9233776899:;;963326755551111,,,,3313335333799.....23322666726;;;66772222,,,,47400!,!,!!!!!!!!!!!!!
+</pre>
+
+Here is the alignment made by clonotypeR
+
+<pre>
+GWYEMNS10GHZUF 16 TRAV14N-3 105 17 49S17M1I29M1I201M99S * 0 0 NNNNNNNNNNNNNCNCNCCTATCCCCTGTGTGCCTTGTCTCCCACGACTCCAATCTCTGACAGTCTGGGGAAGGAGAGACCGCAATTCTGAACTGCTAGTTATGAGAACAGTGCTTTTGACTACTTCCCATGGTACCAGCAGTTCCCTGGGGAAGGCCCTGCTCTCCTGATAGCCATACGTTCAGTGTCCGATAAAAAGGAAGATGGACGATTCACAATCTTCTTCAATAAAAGGGAGAAAAATCTCTCCTTGCACATCAAAGACTCTCAGCCTGGAGACTCAGCCACCTACTTCTGTGCAACTTCAAGTGGCCAGAAGCTGGTTTTTGGCCAGGGGACCATATTAAAGGTGTACCTGCACATCCAGAACCCAGAACCTGCTGTGTACCAGTTAGTC !!!!!!!!!!!!!,!,!00474,,,,22227766;;;62766622332.....9973335333133,,,,111155557623369;;:9986773329<223366:...3933322223998<444000<<<<><<<?ABDD?????D;;;;DD???:::BBAAAABD:666FFFFFFDDFFFDDB8988A20//222>>>=AAA@BAA??==AAAAB==:;<AA?88D==;;:::4F;7533??ABB5544>@@@@@?011==BBBBBDDFFFFFFFFFFFFCCCCCFFFFFFFFFFFFFFFFFDDDFDDDFDBAAA>>53310000226694445DFFFHIIIHHHIIIIIIIDFHFFDDDGGFF<=666FHFFFHIIIIFFFFFFFF;;::FFF AS:i:233 XS:i:218 XF:i:3 XE:i:4 XN:i:0
+</pre>
+
+The problem was that the V segment was completely digested in favor of the J segment.
+
+<pre>
+ 351 400
+GWYEMNS10GHZUF CTGTGCAACTTCAAGTGGCCAGAAGCTGGTTTTTGGCCAGGGGACCATAT
+TRAJ16 ~~~~GCAACTTCAAGTGGCCAGAAGCTGGTTTTTGGCCAGGGGACCATAT
+TRAV14N-3 CTGTGCAGC...AAGTG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
+
+ 401 450
+GWYEMNS10GHZUF TAAAGGTGTACCTGCACATCCAGAACCCAGAACCTGCTGTGTACCAGTTA
+TRAJ16 TAAAGGTGTACCTGC~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
+TRAV14N-3 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
+</pre>
+
+This triggered an infinite loop when calling `is.germline()`.
+
+[[Done]] in `42ab98729c5c77462b5929b00ee973074ae4c1c7`.
+
+Now the function should return as in the following example.
+
+<pre>
+yassai_identifier(c(V="TRAV14N-3", J="TRAJ16", dna="GCAACTTCAAGTGGCCAGAAGCTGGTT", pep="ATSSGQKLV"))
+## [1] "a.A14N3A16L9"
+</pre>
diff --git a/Bugs/Different_clonotypes_give_the_same_Yassai_identifier..mdwn b/Bugs/Different_clonotypes_give_the_same_Yassai_identifier..mdwn
new file mode 100644
index 0000000..a4efb15
--- /dev/null
+++ b/Bugs/Different_clonotypes_give_the_same_Yassai_identifier..mdwn
@@ -0,0 +1,31 @@
+Is it a bug in the software or a bug in the concept ?
+
+<pre>
+> rownames(dd)[grep('aAn.1A14-1A43L9', dd.yassai)]
+[1] "TRAV14-1 TRAJ43 GCAGCAGCTAACAACAATGCCCCACGA AAANNNAPR"
+[2] "TRAV14-1 TRAJ43 GCAGCTAATAACAACAATGCCCCACGA AANNNNAPR"
+> V_after_C['TRAV14-1',]
+[1] "GCAGCAAGTG"
+> J_before_FGxG['TRAJ43',]
+[1] "GCAATAACAACAATGCCCCACGA"
+</pre>
+
+<pre>
+aAn.1A14-1A43L9
+ A A A N N N A P R
+GCA GCA GCT AAC AAC AAT GCC CCA CGA
+GCA GCA agt g
+ gc aaT AAC AAC AAT GCC CCA CGA
+</pre>
+
+<pre>
+aAn.1A14-1A43L9
+ A A N N N N A P R
+GCA GCT AAT AAC AAC AAT GCC CCA CGA
+GCA GCa agt g
+ gc AAT AAC AAC AAT GCC CCA CGA
+</pre>
+
+----
+
+This is a collision (different colonotypes giving the same Yassai ID) rather than a bug in the implementation → [[done]].
diff --git a/Bugs/Does_not_work_with_EMBOSS_6.6.0..mdwn b/Bugs/Does_not_work_with_EMBOSS_6.6.0..mdwn
new file mode 100644
index 0000000..c95cbe8
--- /dev/null
+++ b/Bugs/Does_not_work_with_EMBOSS_6.6.0..mdwn
@@ -0,0 +1,18 @@
+The reason is the following bug in EMBOSS.
+
+<pre>
+echo -e '>A\nAAAAAA' > test-1.fa
+cat test-1.fa
+# >A
+# AAAAAA
+seqret test-1.fa:A stdout
+# Read and write (return) sequences
+# >A
+# AAAAAA
+mkdir test
+seqret test-1.fa:A stdout
+# Read and write (return) sequences
+# Error: Query 'test-1.fa:A' query field '1.fa' not defined for datatype 'sequence'
+# Error: Unable to read sequence 'test-1.fa:A'
+# Died: seqret terminated: Bad value for '-sequence' and no prompt
+</pre>
diff --git a/Bugs/Incorrect_identifiers_when_V-J_boundary_is_a_codon_boundary_.mdwn b/Bugs/Incorrect_identifiers_when_V-J_boundary_is_a_codon_boundary_.mdwn
new file mode 100644
index 0000000..1648dce
--- /dev/null
+++ b/Bugs/Incorrect_identifiers_when_V-J_boundary_is_a_codon_boundary_.mdwn
@@ -0,0 +1,13 @@
+<pre>
+> yassai_identifier(c(V='TRAV2', J='TRAJ61', dna='ATTGTGACTGACACAGGTACAGAATTAATAGGAAATTGGCA', pep='IVTDTGTELIGNW'))
+[1] "tg.integer(0)A2A61L13"
+</pre>
+
+[[Done]] in `2b8514d18f312f627255b0f2eb0ec1bf4ffa48dd`, by return an empty chain instead of `integer(0)` when receiving an empty chain.
+
+Result after correction:
+
+<pre>
+> yassai_identifier(c(V='TRAV2', J='TRAJ61', dna='ATTGTGACTGACACAGGTACAGAATTAATAGGAAATTGGCA', pep='IVTDTGTELIGNW'))
+[1] "tg.A2A61L13"
+</pre>
diff --git a/Bugs/Use_basename_case-insensitively.mdwn b/Bugs/Use_basename_case-insensitively.mdwn
new file mode 100644
index 0000000..95a3173
--- /dev/null
+++ b/Bugs/Use_basename_case-insensitively.mdwn
@@ -0,0 +1,6 @@
+Problem:
+
+ $ basename foo.fastq .fastq
+ foo
+ $ basename foo.FASTQ .fastq
+ foo.FASTQ
diff --git a/Bugs/clonotypeR_detect_should_test_the_existence_of_the_FASTQ_file..mdwn b/Bugs/clonotypeR_detect_should_test_the_existence_of_the_FASTQ_file..mdwn
new file mode 100644
index 0000000..3899e4e
--- /dev/null
+++ b/Bugs/clonotypeR_detect_should_test_the_existence_of_the_FASTQ_file..mdwn
@@ -0,0 +1,18 @@
+This would prevent horrors like:
+
+<pre>
+$ ../scripts/clonotypeR detect .fastq
+[bam_header_read] EOF marker is absent. The input is probably truncated.
+[bsw2_aln] fail to open file '.fastq'. Abort!
+[samopen] SAM header is present: 169 sequences.
+[sam_read1] reference 'SN:TRDV5 LN:344
+3
+
+19
+
+3
+
+
+' is recognized as '*'.
+[main_samview] truncated file.
+</pre>
diff --git a/Bugs/done.mdwn b/Bugs/done.mdwn
new file mode 100644
index 0000000..0a666ab
--- /dev/null
+++ b/Bugs/done.mdwn
(Diff truncated)
Explicitely import setMethod in NAMESPACE.
diff --git a/DESCRIPTION b/DESCRIPTION
index c73ec16..8e69f9b 100644
--- a/DESCRIPTION
+++ b/DESCRIPTION
@@ -15,7 +15,7 @@ Description: High throughput analysis of T cell antigen receptor sequences
The purpose of this package is to process and quantitatively analyse millions
of V-CDR3-J combination, called clonotypes, from multiple sequence libraries.
License: file LICENSE
-Depends: methods
+Imports: methods
Suggests: BiocGenerics, edgeR, knitr, pvclust, RUnit, vegan
VignetteBuilder: knitr
Packaged: 2013-12-11 10:22:39 UTC; charles
diff --git a/NAMESPACE b/NAMESPACE
index d75f824..2d083c2 100644
--- a/NAMESPACE
+++ b/NAMESPACE
@@ -1 +1,2 @@
+importFrom(methods, setMethod)
exportPattern("^[[:alpha:]]+")
setting up git-svn bridge
diff --git a/DESCRIPTION b/DESCRIPTION index a0daca5..c73ec16 100644 --- a/DESCRIPTION +++ b/DESCRIPTION @@ -1,7 +1,7 @@ Package: clonotypeR Type: Package Title: High throughput analysis of T cell antigen receptor sequences -Version: 1.1.6 +Version: 1.3.1 Date: 2014-04-08 Author: Charles Plessy <plessy@riken.jp> Maintainer: Charles Plessy <plessy@riken.jp> diff --git a/vignettes/clonotypeR.Rmd b/vignettes/clonotypeR.Rmd index f121ece..3de0e56 100644 --- a/vignettes/clonotypeR.Rmd +++ b/vignettes/clonotypeR.Rmd @@ -39,7 +39,7 @@ examples are available on line at *This example analysis assumes a [unix](https://en.wikipedia.org/wiki/Operating%5Fsystem%23UNIX%5Fand%5FUNIX%2Dlike%5Foperating%5Fsystems) -system (Linux, Mac OS, …)* +system (Linux, Mac OS, ...)* Test data @@ -105,11 +105,11 @@ or to calculate distance between libraries, for instance with the `vegan` package. -Example data (3 × 2,000 reads) +Example data (3 x 2,000 reads) ------------------------------ The data provided on-line at <http://clonotyper.branchable.com/example_data/> -is a sub-sample of three sequence librairies of mouse T cell receptors α (2,000 +is a sub-sample of three sequence librairies of mouse T cell receptors α (2,000 reads each) made on the 454 Titanium or the 454 junior platforms. The original libraries will be deposited in public databanks after publication in a peer-reviewed journal.
News entry for the new stable release.
diff --git a/index.mdwn b/index.mdwn
index 7a89d51..357e7b9 100644
--- a/index.mdwn
+++ b/index.mdwn
@@ -45,6 +45,8 @@ to try alternative solutions, you can have a look at
### Recent news
+ * March 2014: New stable version [1.2](http://www.bioconductor.org/packages/2.14/bioc/html/clonotypeR.html)
+ released on Bioconductor.
* 11 December 2013: Version 1.1.3 adding a `long` option to `yassai_identifier`, solving
the problem of ID collisions.
* 23 October 2013: Version 1.1.2 adding a new option to `clonotype_table` for randomly
Does not work with EMBOS 6.6.0.
diff --git a/Bugs/Does_not_work_with_EMBOSS_6.6.0..mdwn b/Bugs/Does_not_work_with_EMBOSS_6.6.0..mdwn new file mode 100644 index 0000000..c95cbe8 --- /dev/null +++ b/Bugs/Does_not_work_with_EMBOSS_6.6.0..mdwn @@ -0,0 +1,18 @@ +The reason is the following bug in EMBOSS. + +<pre> +echo -e '>A\nAAAAAA' > test-1.fa +cat test-1.fa +# >A +# AAAAAA +seqret test-1.fa:A stdout +# Read and write (return) sequences +# >A +# AAAAAA +mkdir test +seqret test-1.fa:A stdout +# Read and write (return) sequences +# Error: Query 'test-1.fa:A' query field '1.fa' not defined for datatype 'sequence' +# Error: Unable to read sequence 'test-1.fa:A' +# Died: seqret terminated: Bad value for '-sequence' and no prompt +</pre>
Should use `basename` canse-insensitively…
diff --git a/Bugs/Use_basename_case-insensitively.mdwn b/Bugs/Use_basename_case-insensitively.mdwn new file mode 100644 index 0000000..95a3173 --- /dev/null +++ b/Bugs/Use_basename_case-insensitively.mdwn @@ -0,0 +1,6 @@ +Problem: + + $ basename foo.fastq .fastq + foo + $ basename foo.FASTQ .fastq + foo.FASTQ
replace non-ascii characters in vignette so build does not time out on Mavericks
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@90751 bc3139a8-67e5-0310-9ffc-ced21a209358
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@90751 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/DESCRIPTION b/DESCRIPTION index 1309b59..c73ec16 100644 --- a/DESCRIPTION +++ b/DESCRIPTION @@ -1,7 +1,7 @@ Package: clonotypeR Type: Package Title: High throughput analysis of T cell antigen receptor sequences -Version: 1.3.0 +Version: 1.3.1 Date: 2014-04-08 Author: Charles Plessy <plessy@riken.jp> Maintainer: Charles Plessy <plessy@riken.jp> diff --git a/vignettes/clonotypeR.Rmd b/vignettes/clonotypeR.Rmd index f121ece..3de0e56 100644 --- a/vignettes/clonotypeR.Rmd +++ b/vignettes/clonotypeR.Rmd @@ -39,7 +39,7 @@ examples are available on line at *This example analysis assumes a [unix](https://en.wikipedia.org/wiki/Operating%5Fsystem%23UNIX%5Fand%5FUNIX%2Dlike%5Foperating%5Fsystems) -system (Linux, Mac OS, …)* +system (Linux, Mac OS, ...)* Test data @@ -105,11 +105,11 @@ or to calculate distance between libraries, for instance with the `vegan` package. -Example data (3 × 2,000 reads) +Example data (3 x 2,000 reads) ------------------------------ The data provided on-line at <http://clonotyper.branchable.com/example_data/> -is a sub-sample of three sequence librairies of mouse T cell receptors α (2,000 +is a sub-sample of three sequence librairies of mouse T cell receptors α (2,000 reads each) made on the 454 Titanium or the 454 junior platforms. The original libraries will be deposited in public databanks after publication in a peer-reviewed journal.
Second version bump after creating 2.14 release branch.
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@88840 bc3139a8-67e5-0310-9ffc-ced21a209358
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@88840 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/DESCRIPTION b/DESCRIPTION index 1b4302b..1309b59 100644 --- a/DESCRIPTION +++ b/DESCRIPTION @@ -1,7 +1,7 @@ Package: clonotypeR Type: Package Title: High throughput analysis of T cell antigen receptor sequences -Version: 1.2.0 +Version: 1.3.0 Date: 2014-04-08 Author: Charles Plessy <plessy@riken.jp> Maintainer: Charles Plessy <plessy@riken.jp>
First version bump prior to creating 2.14 branch.
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@88838 bc3139a8-67e5-0310-9ffc-ced21a209358
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@88838 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/DESCRIPTION b/DESCRIPTION index a0daca5..1b4302b 100644 --- a/DESCRIPTION +++ b/DESCRIPTION @@ -1,7 +1,7 @@ Package: clonotypeR Type: Package Title: High throughput analysis of T cell antigen receptor sequences -Version: 1.1.6 +Version: 1.2.0 Date: 2014-04-08 Author: Charles Plessy <plessy@riken.jp> Maintainer: Charles Plessy <plessy@riken.jp>
Commit made by the Bioconductor Git-SVN bridge.
Consists of 1 commit(s).
Commit information:
Commit id: d1cde58657ad1aac7125dbffc4c9d7b7a500236d
Commit message:
Spellchecked ChangeLog.
The goal is to test the commit hook…
Committed by Charles Plessy <plessy at riken.jp>
Commit date: 2014-04-09T12:43:28+09:00
From: Bioconductor Git-SVN Bridge <bioc-sync@bioconductor.org>
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@88640 bc3139a8-67e5-0310-9ffc-ced21a209358
Consists of 1 commit(s).
Commit information:
Commit id: d1cde58657ad1aac7125dbffc4c9d7b7a500236d
Commit message:
Spellchecked ChangeLog.
The goal is to test the commit hook…
Committed by Charles Plessy <plessy at riken.jp>
Commit date: 2014-04-09T12:43:28+09:00
From: Bioconductor Git-SVN Bridge <bioc-sync@bioconductor.org>
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@88640 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/ChangeLog b/ChangeLog index 96b84e2..8c90a52 100644 --- a/ChangeLog +++ b/ChangeLog @@ -11,7 +11,7 @@ * Change biocviews to “Sequencing”, 2013-12-11 Charles Plessy <plessy@riken> - * Commited 1.1.3 to Bioconductor. + * Committed 1.1.3 to Bioconductor. * Fixed two bugs in yassai_identifier(). - Infinite loop when the CDR3 is fully contained in the J segment. - Bogus 'integer(0)' output when there are only germline residues.
Commit made by the Bioconductor Git-SVN bridge.
Consists of 4 commit(s).
Commit information:
Commit id: c96f345271782e2a274912f2ae6e88097541f56c
Commit message:
Renamed the NEWS file “ChangeLog”, according to its contents.
Committed by Charles Plessy <plessy at riken.jp>
Commit date: 2014-04-08T09:33:36+09:00
Commit id: 4a67d1221f27e9fdcb7af0ef0dd27abfb5c8c46c
Commit message:
Synthethic release notes to be used with utils::news() in R.
Committed by Charles Plessy <plessy at riken.jp>
Commit date: 2014-04-08T09:51:21+09:00
Commit id: e1791c38aaeca01f11082d0afef37c5cd6defacc
Commit message:
Repair DESCRIPTION file.
Committed by Charles Plessy <plessy at riken.jp>
Commit date: 2014-04-08T15:43:09+09:00
Commit id: a8aa49a05e10bc943a44fa3809766a88c9a2fa8d
Commit message:
Version 1.1.6.
Committed by Charles Plessy <plessy at riken.jp>
Commit date: 2014-04-08T15:44:25+09:00
From: Bioconductor Git-SVN Bridge <bioc-sync@bioconductor.org>
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@88639 bc3139a8-67e5-0310-9ffc-ced21a209358
Consists of 4 commit(s).
Commit information:
Commit id: c96f345271782e2a274912f2ae6e88097541f56c
Commit message:
Renamed the NEWS file “ChangeLog”, according to its contents.
Committed by Charles Plessy <plessy at riken.jp>
Commit date: 2014-04-08T09:33:36+09:00
Commit id: 4a67d1221f27e9fdcb7af0ef0dd27abfb5c8c46c
Commit message:
Synthethic release notes to be used with utils::news() in R.
Committed by Charles Plessy <plessy at riken.jp>
Commit date: 2014-04-08T09:51:21+09:00
Commit id: e1791c38aaeca01f11082d0afef37c5cd6defacc
Commit message:
Repair DESCRIPTION file.
Committed by Charles Plessy <plessy at riken.jp>
Commit date: 2014-04-08T15:43:09+09:00
Commit id: a8aa49a05e10bc943a44fa3809766a88c9a2fa8d
Commit message:
Version 1.1.6.
Committed by Charles Plessy <plessy at riken.jp>
Commit date: 2014-04-08T15:44:25+09:00
From: Bioconductor Git-SVN Bridge <bioc-sync@bioconductor.org>
git-svn-id: https://hedgehog.fhcrc.org/bioconductor/trunk/madman/Rpacks/clonotypeR@88639 bc3139a8-67e5-0310-9ffc-ced21a209358
diff --git a/ChangeLog b/ChangeLog
new file mode 100644
index 0000000..96b84e2
--- /dev/null
+++ b/ChangeLog
@@ -0,0 +1,80 @@
+2014-04-08 Charles Plessy <plessy@riken.jp>
+ * Version 1.1.6
+ * Transfer “NEWS” to ChangeLog and add release notes to “NEWS”.
+
+2014-04-03 Charles Plessy <plessy@riken.jp>
+ * Version 1.1.5
+ * Mention the GitHub bridge in the documentation
+
+2014-03-05 Bioc admins
+ * Version 1.1.4.
+ * Change biocviews to “Sequencing”,
+
+2013-12-11 Charles Plessy <plessy@riken>
+ * Commited 1.1.3 to Bioconductor.
+ * Fixed two bugs in yassai_identifier().
+ - Infinite loop when the CDR3 is fully contained in the J segment.
+ - Bogus 'integer(0)' output when there are only germline residues.
+ * Avoid more collisions by indicating the position of the V-J junction
+ when there is no codon ID to indicate.
+ * Mark and filter out clonotypes with ambiguous ('N') nucleotides.
+
+2013-12-05 Charles Plessy <plessy@riken>
+ * New "long" option to yassai_identifier(), to avoid collisions.
+
+2013-11-19 Charles Plessy <plessy@riken.jp>
+ * New references from NCBI, updating TRDV5.
+
+2013-10-23 Charles Plessy <plessy@riken.jp>
+ * Commited 1.1.2 to Bioconductor.
+ * clonotype_table: new option to randomly "sample" libraries.
+
+2013-10-17 Charles Plessy <plessy@riken.jp>
+ * Commited 1.1.1 to Bioconductor.
+ * common_clonotypes: new mode to calculate the "abundance" relatively
+ to one library.
+
+2013-10-07 Charles Plessy <plessy@riken.jp>
+ * Commited 0.99.6 to Bioconductor.
+ * Added unit tests for yassai_identifier().
+
+2013-08-01 Charles Plessy <plessy@riken.jp>
+ * Unified the syntax of common_clonotypes and unique_clonotypes.
+
+2013-05-07 Charles Plessy <plessy@riken.jp>
+ * Resubmitted 0.99.5 to Bioconductor.
+ * Distribute a copy of the clonotypes extracted from example_data.
+ * Execute all examples in the vignette.
+
+2013-05-01 Charles Plessy <plessy@riken.jp>
+
+ * Resubmitted 0.99.4 to Bioconductor
+ * Moved the Markdown vignette to '/vignettes'.
+ * Added executable example with test data to the vignette.
+
+2013-04-26 Charles Plessy <plessy@riken.jp>
+
+ * Resubmitted 0.99.3 to Bioconductor
+ * Moved extra data to 'inst/extdata'.
+ * Moved the Markdown vignette to 'inst/vignettes'.
+
+2013-04-15 Charles Plessy <plessy@riken.jp>
+
+ * Resubmission after correcting yassai_identifier() and other warnings.
+
+2013-01-08 Charles Plessy <plessy@riken.jp>
+
+ * Leaner Bioconductor package, without the wiki documentation.
+
+2012-..... Charles Plessy <plessy@riken.jp>
+
+ * Many entries missing.
+
+2012-10-10 Charles Plessy <plessy@riken.jp>
+
+ * Corrected Frenglish “improductive” with “unproductive”.
+ This can break backwards compatibility.
+
+2012-09-06 Charles Plessy <plessy@riken.jp>
+
+ * Initial release
diff --git a/DESCRIPTION b/DESCRIPTION
index ee152f8..a0daca5 100644
--- a/DESCRIPTION
+++ b/DESCRIPTION
@@ -1,21 +1,19 @@
Package: clonotypeR
Type: Package
Title: High throughput analysis of T cell antigen receptor sequences
-Version: 1.1.4
-Date: 2013-12-11
+Version: 1.1.6
+Date: 2014-04-08
Author: Charles Plessy <plessy@riken.jp>
Maintainer: Charles Plessy <plessy@riken.jp>
-Description: High throughput analysis of T cell antigen receptor
- sequences The genes encoding T cell receptors are created by
- somatic recombination, generating an immense combination of V,
- (D) and J segments. Additional processes during the
- recombination create extra sequence diversity between the V an
- J segments. Collectively, this hyper-variable region is called
- the CDR3 loop.
+Description: High throughput analysis of T cell antigen receptor sequences
+ The genes encoding T cell receptors are created by somatic recombination,
+ generating an immense combination of V, (D) and J segments. Additional
+ processes during the recombination create extra sequence diversity between the
+ V an J segments. Collectively, this hyper-variable region is called the CDR3
+ loop.
.
- The purpose of this package is to process and quantitatively analyse
- millions of V-CDR3-J combination, called clonotypes, from
- multiple sequence libraries.
+ The purpose of this package is to process and quantitatively analyse millions
+ of V-CDR3-J combination, called clonotypes, from multiple sequence libraries.
License: file LICENSE
Depends: methods
Suggests: BiocGenerics, edgeR, knitr, pvclust, RUnit, vegan
diff --git a/NEWS b/NEWS
index f3e6131..e8067a7 100644
--- a/NEWS
+++ b/NEWS
@@ -1,76 +1,28 @@
-2014-04-03 Charles Plessy <plessy@riken.jp>
- * Version 1.1.5
- * Mention the GitHub bridge in the documentation
+Changes in version 1.2.0
-2014-03-05 Bioc admins
- * Version 1.1.4.
- * Change biocviews to “Sequencing”,
+NEW FEATURES
-2013-12-11 Charles Plessy <plessy@riken>
- * Commited 1.1.3 to Bioconductor.
- * Fixed two bugs in yassai_identifier().
- - Infinite loop when the CDR3 is fully contained in the J segment.
- - Bogus 'integer(0)' output when there are only germline residues.
- * Avoid more collisions by indicating the position of the V-J junction
- when there is no codon ID to indicate.
- * Mark and filter out clonotypes with ambiguous ('N') nucleotides.
+ o Added a “long” option to yassai_identifier(), where every amino acid is
+ represented. This solves the problem of ID collisions, where a single
+ identifier could be produced by two different clonotypes.
-2013-12-05 Charles Plessy <plessy@riken>
- * New "long" option to yassai_identifier(), to avoid collisions.
+ o Added a new option to clonotype_table() for randomly sampling libraries.
-2013-11-19 Charles Plessy <plessy@riken.jp>
- * New references from NCBI, updating TRDV5.
+ o Added a new mode to common_clonotypes() for calculating the abundance
+ relatively to one library.
-2013-10-23 Charles Plessy <plessy@riken.jp>
- * Commited 1.1.2 to Bioconductor.
- * clonotype_table: new option to randomly "sample" libraries.
+ o Unified the syntax of common_clonotypes() and unique_clonotypes().
-2013-10-17 Charles Plessy <plessy@riken.jp>
- * Commited 1.1.1 to Bioconductor.
- * common_clonotypes: new mode to calculate the "abundance" relatively
- to one library.
+BUG FIXES
-2013-10-07 Charles Plessy <plessy@riken.jp>
- * Commited 0.99.6 to Bioconductor.
- * Added unit tests for yassai_identifier().
+ o Removed infinite loop in yassai_identifier() when the germinal V
+ sequence was completely absent from the CDR3.
-2013-08-01 Charles Plessy <plessy@riken.jp>
- * Unified the syntax of common_clonotypes and unique_clonotypes.
+ o Corrected output bug where “integer(0)” was returned if the V–J
+ boundary was a codon boundary.
-2013-05-07 Charles Plessy <plessy@riken.jp>
- * Resubmitted 0.99.5 to Bioconductor.
- * Distribute a copy of the clonotypes extracted from example_data.
- * Execute all examples in the vignette.
+ o yassai_identifier(): properly encode the names of the V and J segments.
-2013-05-01 Charles Plessy <plessy@riken.jp>
+Changes in version 1.0.0
- * Resubmitted 0.99.4 to Bioconductor
- * Moved the Markdown vignette to '/vignettes'.
- * Added executable example with test data to the vignette.
-
-2013-04-26 Charles Plessy <plessy@riken.jp>
-
- * Resubmitted 0.99.3 to Bioconductor
- * Moved extra data to 'inst/extdata'.
- * Moved the Markdown vignette to 'inst/vignettes'.
-
-2013-04-15 Charles Plessy <plessy@riken.jp>
(Diff truncated)